2ECJ


Conserved Protein Domain Family
RING-HC_TRIM39_C-IV

?
cd16601: RING-HC_TRIM39_C-IV 
Click on image for an interactive view with Cn3D
RING finger, HC subclass, found in tripartite motif-containing protein 39 (TRIM39) and similar proteins
TRIM39, also known as RING finger protein 23 (RNF23) or testis-abundant finger protein, is an E3 ubiquitin-protein ligase that plays a role in controlling DNA damage-induced apoptosis through inhibition of the anaphase promoting complex (APC/C), a multiprotein ubiquitin ligase that controls multiple cell cycle regulators, including cyclins, geminin, and others. TRIM39 also functions as a regulator of several key processes in the proliferative cycle. It directly regulates p53 stability. It modulates cell cycle progression and DNA damage responses via stabilizing p21. Moreover, TRIM39 negatively regulates the nuclear factor kappaB (NFkappaB)-mediated signaling pathway through stabilization of Cactin, an inhibitor of NFkappaB- and Toll-like receptor (TLR)-mediated transcriptions, which is induced by inflammatory stimulants such as tumor necrosis factor alpha (TNFalpha). Furthermore, TRIM39 is a MOAP-1-binding protein that can promote apoptosis signaling through stabilization of MOAP-1 via the inhibition of its poly-ubiquitination process. TRIM39 belongs to the C-IV subclass of TRIM (tripartite motif) family of proteins that are defined by their N-terminal RBCC (RING, Bbox, and coiled coil) domains, including three consecutive zinc-binding domains, a C3HC4-type RING-HC finger, Bbox1 and Bbox2, and a coiled coil region, as well as a B30.2/SPRY (SplA and ryanodine receptor) domain positioned C-terminal to the RBCC domain.
Statistics
?
PSSM-Id: 319515
View PSSM: cd16601
Aligned: 3 rows
Threshold Bit Score: 70.468
Threshold Setting Gi: 159164368
Created: 21-Apr-2016
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding siteRING-HC finger
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Structure:2ECJ; Homo sapiens tripartite motif-containing protein 39 RING domain binds two Zn2+ ions through its RING-HC finger
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
Feature 1           #  #           # #  #  #             #  #
2ECJ_A        15 EASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC 58
gi 56405385   26 EASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC 69
gi 465958396  13 EASCSVCLEYLKDPVIIDCGHNFCRVCITRWWEELNRDFPCPVC 56

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap