Conserved Protein Domain Family
RING2-HC_MIB1

?
cd16725: RING2-HC_MIB1 
RING finger 2, HC subclass, found in mind bomb 1 (MIB1) and similar proteins
MIB1, also known as DAPK-interacting protein 1 (DIP-1) or zinc finger ZZ type with ankyrin repeat domain protein 2, is a large, multi-domain E3 ubiquitin-protein ligase that promotes ubiquitination of the cytoplasmic tails of Notch ligands, and thus plays an essential role in controlling metazoan development by Notch signaling. It is also involved in Wnt/beta-catenin signaling and nuclear factor (NF)-kappaB signaling, and has been implicated in innate immunity, neuronal function, genomic stability, and cell death. MIB1 contains an MZM region with two Mib-Herc2 domains flanking a ZZ zinc finger, a REP region including two tandem Mib repeats, an ANK region that spans ankyrin repeats, and a RNG region consisted of three C3HC4-type RING-HC fingers. This family corresponds to the second RING-HC finger.
Statistics
?
PSSM-Id: 319639
View PSSM: cd16725
Aligned: 18 rows
Threshold Bit Score: 55.5349
Threshold Setting Gi: 156223774
Created: 3-May-2013
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteRING-HC finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:Based on the structural evidence that Homo sapiens RNF123 (2MA6) binds two Zn2+ ions through its RING-HC finger.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....*..
Feature 1          #  #           # #   #  #      #  # 
gi 68565512   865 ECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCR 901
gi 443712746  133 ECVVCSDRKASMLFKPCGHMCACDGCGALMKKCVQCL 169
gi 321479040  258 ECVVCSDKKASVLFRPCGHMCACDGCAALMKKCVQCR 294
gi 675366412  210 ECVVCSDKRASVLFKPCGHMCACDGCAALMKKCVQCR 246
gi 585652185  825 ECVVCSDKKASTLFEPCGHMCACDSCAALMKKCVQCR 861
gi 699238143  968 ECCVCSDKQSSVVFKPCGHICACQACSNLMKKCIRCR 1004
gi 761911518  784 ECLVCSQRLADVLFKPCLHMVACESCAIVMKKCVHCR 820
gi 68565370  1016 ECLVCSDRRAAVFFRPCGHMVACEHCSALMKKCVLCR 1052
gi 156223774   60 ECMVCSEKKSQLLFKPCNHMVACEGCGSLMKKCIQCR 96
gi 919003623  868 ECVVCSDKKASILFKPCGHMCACDGCAALMKKCVQCR 904

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap