Conserved Protein Domain Family
RING-HC_PCGF1

?
cd16733: RING-HC_PCGF1 
RING finger, HC subclass, found in polycomb group RING finger protein 1 (PCGF1) and similar proteins
PCGF1, also known as nervous system Polycomb-1 (NSPc1) or RING finger protein 68 (RNF68), is one of six PcG RING finger (PCGF) homologs (PCGF1/NSPc1, PCGF2/Mel-18, PCGF3, PCGF4/BMI1, PCGF5, and PCGF6/MBLR) and serves as the core component of a noncanonical Polycomb repressive complex 1 (PRC1)-like BCOR complex that also contains RING1, RNF2, RYBP, SKP1, as well as the BCL6 co-repressor BCOR and the histone demethylase KDM2B, and is required to maintain the transcriptionally repressive state of some genes, such as Hox genes, BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. PCGF1 promotes cell cycle progression and enhances cell proliferation as well. It is a cell growth regulator that acts as a transcriptional repressor of p21Waf1/Cip1 via the retinoid acid response element (RARE element). Moreover, PCGF1 functions as an epigenetic regulator involved in hematopoietic cell differentiation. It cooperates with the transcription factor runt-related transcription factor 1 (Runx1) in regulating differentiation and self-renewal of hematopoietic cells. Furthermore, PCGF1 represents a physical and functional link between Polycomb function and pluripotency. PCGF1 contains a C3HC4-type RING-HC finger.
Statistics
?
PSSM-Id: 319647
View PSSM: cd16733
Aligned: 9 rows
Threshold Bit Score: 84.2687
Threshold Setting Gi: 675363743
Created: 26-Jul-2013
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteRING-HC finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:Based on the structural evidence that Homo sapiens PCGF4 (3PRG) binds two Zn2+ ions thorugh its RING-HC finger.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
Feature 1           #  #            # #  #  #          #  # 
gi 223590124  44 HIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCN 86
gi 223590126  42 HIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPLCN 84
gi 82209850   42 HIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCN 84
gi 632976548  36 HIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCN 78
gi 260817655 421 HIVCILCAGYFIDATTVTECLHTFCKSCIVKYLQTSKFCPMCN 463
gi 585719412  46 HVVCILCAGYFIDATTVTECLHTFCKSCIVKYLQTSKCCPMCN 88
gi 390335217  21 HIVCILCAGYYIDATTVTECLHTFCKSCIVKYLQTSKICPMCN 63
gi 675363743  15 QIVCILCAGYFIDATTITECLHTFCKSCIVKYLQTTKYCPMCN 57
gi 449283268  14 HIVCCLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCN 56

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap