3RPG,2CKL,4R8P,2H0D


Conserved Protein Domain Family
RING-HC_PCGF4

?
cd16736: RING-HC_PCGF4 
Click on image for an interactive view with Cn3D
RING finger found in polycomb group RING finger protein 4 (PCGF4) and similar proteins
PCGF4, also known as polycomb complex protein BMI-1 (B cell-specific Moloney murine leukemia virus integration site 1) or RING finger protein 51 (RNF51), is one of six PcG RING finger (PCGF) homologs (PCGF1/NSPc1, PCGF2/Mel-18, PCGF3, PCGF4/BMI1, PCGF5, and PCGF6/MBLR) and serves as the core component of a canonical Polycomb repressive complex 1 (PRC1), which is composed of a chromodomain-containing protein (CBX2, CBX4, CBX6, CBX7 or CBX8) and a Polyhomeotic protein (PHC1, PHC2, or PHC3), and plays important roles in chromatin compaction and H2AK119 monoubiquitination. PCGF4 associates with the Runx1/CBFbeta transcription factor complex to silence target gene in a PRC2-independent manner. Moreover, PCGF4 is expressed in the hair cells and supporting cells. It can regulate cell survival by controlling mitochondrial function and reactive oxygen species (ROS) level in thymocytes and neurons, thus having an important role in the survival and sensitivity to ototoxic drug of auditory hair cells. Furthermore, PCGF4 controls memory CD4 T-cell survival through direct repression of Noxa gene in an Ink4a- and Arf-independent manner. It is required in neurons to suppress p53-induced apoptosis via regulating the antioxidant defensive response, and also involved in the tumorigenesis of various cancer types. PCGF4 contains a C3HC4-type RING-HC finger.
Statistics
?
PSSM-Id: 319650
View PSSM: cd16736
Aligned: 11 rows
Threshold Bit Score: 95.8417
Threshold Setting Gi: 109158140
Created: 3-May-2013
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Zn binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
Feature 1              #  #            # #  #  #          #  #         
3RPG_B        12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
2CKL_A        12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
4R8P_K        13 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 66
2H0D_A         8 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 61
gi 82196525   12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
gi 82217516   12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
gi 22258801   12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
gi 556998542  12 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 65
gi 585666323  12 LNPHLMCVLCGGYFIDATTIIECLHSFCRTCIVRYLETSKYCPICDTQVHKTRP 65
gi 632945321 266 LNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRP 319
gi 229284735  12 LNPHLMCVICGGYFIDATTIIECLHSFCKTCIVKYLDTSKYCPVCDVQVHKTRP 65

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap