5DIN


Conserved Protein Domain Family
mRING-HC-C3HC3D_LNX2

?
cd16780: mRING-HC-C3HC3D_LNX2 
Click on image for an interactive view with Cn3D
Modified RING finger, HC subclass (C3HC3D-type), found in ligand of numb protein X 2 (LNX2)
LNX2, also known as numb-binding protein 2, or PDZ domain-containing RING finger protein 1 (PDZRN1), is a PDZ domain-containing RING-type E3 ubiquitin ligase responsible for the ubiquitination and degradation of Numb, a component of the Notch signaling pathway that functions in the specification of cell fates during development and is known to control cell numbers during neurogenesis in vertebrates. It interacts with contactin-associated protein 4 (Caspr4, also known as CNTNAP4) in a PDZ domain-dependent manner, which modulates the proliferation and neuronal differentiation of neural progenitor cells (NPCs). LNX2 contains an N-terminal modified C3HC3D-type RING-HC finger, a NPAF motif for Numb/ Numblike-LNX interaction, and four PDZ domains necessary for the binding of substrates, including ErbB2, RhoC, the presynaptic protein CAST, the melanoma/cancer-testis antigen MAGEB18 and several proteins associated with cell junctions, such as JAM4 and the Coxsackievirus and adenovirus receptor (CAR).
Statistics
?
PSSM-Id: 319694
View PSSM: cd16780
Aligned: 7 rows
Threshold Bit Score: 85.3133
Threshold Setting Gi: 939186861
Created: 6-May-2013
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Structure:5DIN; Homo sapiens LNX2 binds two Zn2+ ions through its modified RING-HC finger.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
Feature 1             #  #           # #  #  #          #  #  
5DIN_A        28 DDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRK 72
gi 205945995  44 DDDLVCHICLQPLVQPLDTPCGHTFCARCLRSFLQERDFCPLDRA 88
gi 118404746  43 DDDLVCHICLQPLLQPLDTPCGHTFCFKCLRNFLQEKDFCPLDRK 87
gi 465980025  39 DDELVCHICLQPLLQPMDTPCGHTYCFKCLENFMQEYNFCPMDRK 83
gi 482668125  39 DDDLTCHICLQPLLQPMDTPCGHTYCFKCLENFLQDHNFCPMDRK 83
gi 632965267  43 DDDLVCHICLQPLLQPLDTPCGHTFCYKCLQNFLQEKDFCPLDRK 87
gi 29840784   45 DDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRK 89

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap