4FO9


Conserved Protein Domain Family
SP-RING_PIAS2

?
cd16819: SP-RING_PIAS2 
Click on image for an interactive view with Cn3D
SP-RING finger found in protein inhibitor of activated STAT protein 2 (PIAS2) and similar proteins
PIAS2, also known as androgen receptor-interacting protein 3 (ARIP3), DAB2-interacting protein (DIP), Msx-interacting zinc finger protein (Miz1), PIAS-NY protein, protein inhibitor of activated STAT x, protein inhibitor of activated STAT2, is an E3 SUMO-protein ligase highly expressed in the testis. It functions as a transcriptional activator of BCL2 and is essential for blocking c-MYC-induced apoptosis. It also acts as a negative regulator of cell proliferation, induces expression of the cell-cycle inhibitors p15(Ink4b) and p21(Cip1), and activates transcription of the p21(Cip1) gene in response to UV irradiation. Moreover, PIAS2 associates with topoisomerase II binding protein 1 (TopBP1), an essential activator of the Atr kinase. It thus affects the activity of the Atr checkpoint. Receptor of activated C kinase 1 (RACK1), glucocorticoid receptor (GR)-interacting protein 1 (GRIP1), friend leukemia integration-I (FLI-1), and ubiquitously expressed transcript (UXT) are binding partners of PIAS2. The interaction between UXT and PIAS2 may be important for the transcriptional activation of androgen receptor (AR). PIAS2 contains an N-terminal SAP (scaffold attachment factor A/B (SAF-A/B), acinus, and PIAS) box with the LXXLL signature, a PINT motif, a specific RING finger known as Siz/PIAS (protein inhibitor of activated signal transducer and activator of transcription) RING (SP-RING) finger, and the acidic C-terminal domain.
Statistics
?
PSSM-Id: 319733
View PSSM: cd16819
Aligned: 6 rows
Threshold Bit Score: 100.498
Threshold Setting Gi: 395759482
Created: 22-Mar-2015
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding siteSP-RING finger
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Structure:4FO9; Homo sapiens E3 Sumo Ligase Pias2 binds one Zn2+ ion through its SP-RING finger.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                           # #                    #  #   
4FO9_A       215 SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKK 263
gi 632986111 342 SLMCPLGKMRLTVPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKK 390
gi 71894815  343 SLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKK 391
gi 118404292 342 SLMCPLGKMRLTIPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKK 390
gi 938069591 377 SLMCPLGKMRLIVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKK 425
gi 148234462 342 SLMCPLGKMRLSIPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKK 390

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap