Conserved Protein Domain Family
SP-RING_PIAS4

?
cd16821: SP-RING_PIAS4 
SP-RING finger found in protein inhibitor of activated STAT protein 4 (PIAS4) and similar proteins
PIAS4, also known as PIASy or protein inhibitor of activated STAT protein gamma (PIAS-gamma), is an E3 SUMO-protein ligase that interacts with the androgen receptor (AR) and is involved in ubiquitin signaling pathways. It is associated with macro/microcephaly in the novel interstitial 19p13.3 microdeletion/microduplication syndrome. It also regulates the hypoxia signalling pathway through interacting with the tumor suppressor von Hippel-Lindau (VHL) and leads to VHL sumoylation, oligomerization, and impaired function during growth of pancreatic cancer cells. Moreover, PIAS4 acts as a direct binding partner for vitamin D receptor (VDR) and facilitates its modification with SUMO2. The process of SUMOylation modulates VDR-mediated signaling. As components of the DNA-damage response (DDR), PIAS4 together with PIAS1 promote responses to DNA double-strand breaks (DSBs). They are required for effective ubiquitin-adduct formation mediated by RNF8, RNF168, and BRCA1 at sites of DNA damage. PIAS4 contains an N-terminal SAP (scaffold attachment factor A/B (SAF-A/B), acinus and PIAS) box with the LXXLL signature, a PINT motif, a specific RING finger known as Siz/PIAS (protein inhibitor of activated signal transducer and activator of transcription) RING (SP-RING) finger, and the acidic C-terminal domain.
Statistics
?
PSSM-Id: 319735
View PSSM: cd16821
Aligned: 4 rows
Threshold Bit Score: 98.6037
Threshold Setting Gi: 34922831
Created: 22-Mar-2015
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteSP-RING finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:Based on the structural evidence that Homo sapiens E3 Sumo Ligase Pias2 (4FO9) binds one Zn2+ ion through its SP-RING finger.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                           # #                    #  #   
gi 34922831  323 SLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKP 371
gi 677308934 317 SLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKP 365
gi 35505277  308 SLICPLVKMRLGVPCRVLTCAHLQCFDAVFFLQMNEKKPTWTCPVCDKP 356
gi 148230615 330 SLICPLVKMRLTVPCRAETCAHLQCFDAVFYLQMNEKKPTWTCPVCDKP 378

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap