Conserved Protein Domain Family
ParB_N_like_MT

?
cd16844: ParB_N_like_MT 
ParB N-terminal-like domain, some attached to C-terminal S-adenosylmethionine-dependent methyltransferase domain
This family represents domains related to the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system, fused to a variety of C-terminal domains, including S-adenosylmethionine-dependent methyltransferase-like domains and DUF4417. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.
Statistics
?
PSSM-Id: 319272
View PSSM: cd16844
Aligned: 16 rows
Threshold Bit Score: 81.1588
Threshold Setting Gi: 743967905
Created: 15-Aug-2016
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
putative ParB
Feature 1:putative ParB Box II like motif [polypeptide binding site]
Evidence:
  • Comment:Motif identified in related ParB/Spo0J family proteins
  • Comment:partial match to Spo0J motif
  • Comment:Bacillus subtilis ParB Box II shown to be essential for DNA loop formation in vitro and Spo0J complex formation in vivo
  • Comment:Mutations in B. subtilis (R79A, R80A, R82A) incapacitate Spo0J spreading from parS sites
  • Comment:ParB box may interact with a negatively charged region of another Spo0J molecule
  • Citation:PMID 9915704

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
Feature 1                                        # ## ##               
gi 301640589  21 KNDEQVERMVAAIREFGFRIPVVAKsDGTVVDGHLRLKAARKLGLTEVPVALAD 74
gi 46581282   23 RNDDAIPRMVDALRMFGFRIPLLVTgAGEVVDGHLRLKAAIAMGMTSVPVIVVD 76
gi 950346047  72 SSKSQIARVAQSILSQGFRDPPLIEkDGEIIDGHIRVEAAKSLGFDEIPCVVSD 125
gi 974212557  97 CNPEQVERAIRLIRAYGFISPITIR-RGVVVDGHIRIAAARELGMEAVPCIDVG 149
gi 946130241  69 TSPAQLERVTHAVSQFGFLKPVLIDaSGRIVDGHILVEVARRMGLPDIECTIID 122
gi 950346090  44 QSNRQIAKCRASIGRYGLKRPVLITtDNEIIDGHAIVEAARQLGLTELPCIRVA 97
gi 345047623  23 DRDTALPKMVEALRTWGFRVPLLVTaDGEVVDGEIRLEAARELGMTEAPVLVQD 76
gi 337760936  73 SAAPQSAKVQLSLKRFGICVPILIDsDGRIVHGHVVWEAARSLDLETVPVIRIE 126
gi 822586941  16 KDAKQIARIANSIKTFGQVYPVLLNkVGAIVDGHLVVEAARDLGLEKVYCVRLE 69
gi 743967905  25 HNKAQEEAVANSVLHFGVIKPVVVDeQSRIVAGHVVWRAAKKLGLKRIPVIRVS 78

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap