1AMI


Conserved Protein Domain Family
AcnA_Mitochondrial

?
cd01584: AcnA_Mitochondrial 
Click on image for an interactive view with Cn3D
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle
Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.
Statistics
?
PSSM-Id: 153134
View PSSM: cd01584
Aligned: 13 rows
Threshold Bit Score: 773.151
Threshold Setting Gi: 11611458
Created: 16-Jul-2004
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindingsubstrate
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
1AMI         68 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIH 147 cow
ZP_00116914  63 RVAMQDATAQMALLQFMQAGRPKVAVPSTVHCDHLITAKEGATKDLPFANKESKEVFDFLGSVSNKYGIGFWKPGAGIIH 142 Cytophaga hutchi...
P34455       92 RVAMQDATAQMAMLQFISSGLPKTAVPSTIHCDHLIEAQKGGAQDLARAKDLNKEVFNFLATAGSKYGVGFWKPGSGIIH 171 nematode
NP_944590    97 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQTGGAQDLQKAKEVNQEVYSFLASAGAKYGVGFWKPGSGIIH 176 zebrafish
P19414       91 RVACQDATAQMAILQFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVYDFLASATAKYNMGFWKPGSGIIH 170 baker's yeast
YP_003633    63 RVAMQDATAQMALLQFMSAGRSKVAVPSTVHCDHLIQAKDGATEDLKTANTVNKEVYDFLSSVSNKYGIGFWKPGAGIIH 142 Leptospira inter...
EAK83948    109 RVACQDATAQMALLQFMSAGLPTVAVPTTVHCDHLIEAQVGGAKDLARAIEINKEVYDFLATATAKYGIGFWRPGSGIIH 188 Ustilago maydis 521
NP_989519    97 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLSTAGAKYGVGFWKPGSGIIH 176 chicken
O13966       91 RVACQDATAQMAILQFMSAGMPEVAVPVTVHCDHLIEAYEGGPIDLERANVTNKEVYDFLQTACAKYNIGFWRPGSGIIH 170 fission yeast
AAF01428     97 RVAMQDATAQMAMLQFISSGLARVAVPSTIHCDHLIEAQLGGEKDLKRAKDINQEVYNFLATAAAKYGVGFWKPGSGIIH 176 African clawed frog
P49609       93 RVALQDATAQMALIQFMASARPQVAVPSTIHCDHLIAAEVGAEEDMAKAKSQNKEVYDFLASAGAKYGLGFWKPGSGIIH 172 Gracilaria gracilis
CAC18623    109 RVNMQDASAQMALLQFMTCNLPQPVIPASIHCDHLIVGSKGADEDLKAGIATNNEVFDFLESAGKKYGIDFWPPGAGIIH 188 Neurospora crassa
CAB93521    102 RVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIH 181 fruit fly
Feature 1                          #                                                            
1AMI        148 QIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGI 227 cow
ZP_00116914 143 QVVLENYAFPGGMMIGTDSHTVNAGGLGMLAIGVGGADACDVMAGLPWELKFPKLIGVKLTGKLNGWTAPKDVILKVAGI 222 Cytophaga hutchi...
P34455      172 QIILENYAFPGLLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGIKLTGKLNGWTSAKDVILKVADI 251 nematode
NP_944590   177 QIILENYAYPGVMLIGTDSHTPNGGGLGCICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGSLSGWSSPKDVILKVAGI 256 zebrafish
P19414      171 QIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGRPWELKAPKILGVKLTGKMNGWTSPKDIILKLAGI 250 baker's yeast
YP_003633   143 QVVLENYAFPGGMMIGTDSHTVNAGGLGMIAIGVGGADAVDVMAGMAWELKFPKLIGVKLTGKLSGWASAKDIILKVAGI 222 Leptospira inter...
EAK83948    189 QIILENYAFPGGLMIGTDSHTPNAGGLGMIACGVGGADAVDVMADIPWELKAPKVIGVELKGKMSGWTTPKDVILKVAGE 268 Ustilago maydis 521
NP_989519   177 QIILENYSYPGVMLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWSSPKDVILKVAGI 256 chicken
O13966      171 QIVLENYAFPGGLLIGTDSHTPNAGGLGMVAIGVGGADAVDVMANLPWELKCPKVIGVKLTGQLKGWTSPKDVILKVAGI 250 fission yeast
AAF01428    177 QIILENYAFPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGQLSGWTSPKDVILKVAGI 256 African clawed frog
P49609      173 QIVLENYAFPGLLMIGTDSHTPNAGGLGACAVGVGGADAVDVMVGLPWELKAPKVIGVKLTGKLQEWASPKDVILKVAGI 252 Gracilaria gracilis
CAC18623    189 QTVLENYAVPGLMMLGTDSHSPNAGGLTTITIGVGGADAVEALVGAPWELKAPKILGVRLTGKLNDWVSAKDIILHLTGR 268 Neurospora crassa
CAB93521    182 QIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADI 261 fruit fly
Feature 1                                                                                       
1AMI        228 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGradianladefk----------- 296 cow
ZP_00116914 223 LTVKGGTGAIVEYFGEGATSMSCTGKGTICNMGAEIGATTSTFGYDESMERYLRATGradvadlangikqhl-----nad 297 Cytophaga hutchi...
P34455      252 LTVKGGTGAIVEYFGPGVDSISATGMGTICNMGAEIGATTSVFPYNESMYKYLEATGrkeiaeearkyk----------- 320 nematode
NP_944590   257 LTVKRGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPFNHRMKTYLDKTGrgeiatladenk----------- 325 zebrafish
P19414      251 TTVKGGTGKIVEYFGDGVDTFSATGMGTICNMGAEIGATTSVFPFNKSMIEYLEATGrgkiadfaklyh----------k 320 baker's yeast
YP_003633   223 LTVKGGTGAIVEYFGEGADSLSCTGKGTICNMGAEIGATTSVFGYDRNMREYLLKTNrkevadladkiaehl-----tgd 297 Leptospira inter...
EAK83948    269 LTVKGGTGAIIEYKGPGVESLSCTGMATICNMGAEIGATTSVFPYNERMGDYLRATNrseiadlakgfh----------- 337 Ustilago maydis 521
NP_989519   257 LTVKGGTGAIIEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNTRMKKYLGKTGradiaaladefq----------- 325 chicken
O13966      251 LTVKGGTGAIVEYFGPGVESLSCTGMGTICNMGAEIGATTSIFPFNPRMSEYLRATNrsaiadyaeefa----------- 319 fission yeast
AAF01428    257 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLDKTGrseiasltdefk----------s 326 African clawed frog
P49609      253 LTVKGGTGAIVEYFGEGVDSLSCTGMGTICNMGAEIGATTSMFPYNSRMGDYLKATGrdgiasladsfs----------- 321 Gracilaria gracilis
CAC18623    269 LTVRGGTGYIVEYFGPGIESLSCSGSSTLCNMGAEIGATTSIFPFTEASSRYLKATNreqadkdaknfenftkgtgqdsf 348 Neurospora crassa
CAB93521    262 LTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGragiaseaqkyq----------a 331 fruit fly
Feature 1                                                                    #                  
1AMI        297 dhlvpdsgchyDQLIEINLSELKPHINGPFTPDLAHPVaevgsvaekEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQA 376 cow
ZP_00116914 298 pevyaspekyfDQVIEINLSELEPHLNGPFTPDLATPVskmkeeaekNGWPLKVEWGLIGSCTNSSYEDLSRAASIAKQA 377 Cytophaga hutchi...
P34455      321 dlltaddganyDQIIEINLDTLTPHVNGPFTPDLASSIdklgenakkNGWPLDVKVSLIGSCTNSSYEDMTRAASIAKQA 400 nematode
NP_944590   326 dllvpdsgchyDQLIEINLDELKPHINGPFTPDLAHPVsdigsvaekNGWPLDVKVGLIGSCTNSSYEDMGRAASLAKQA 405 zebrafish
P19414      321 dllsadkdaeyDEVVEIDLNTLEPYINGPFTPDLATPVskmkevavaNNWPLDVRVGLIGSCTNSSYEDMSRSASIVKDA 400 baker's yeast
YP_003633   298 kevyanpsqyfDQVIEINLSELEPYINGPFTPDLATPLskfkeavqqNGWPTNLEVGLIGSCTNSSYEDITRAASVAKQA 377 Leptospira inter...
EAK83948    338 rnllpdtgaeyDSHLEINLDTLEPHINGPFTPDLATPLskfaeevkkNDWPEELKVSLIGSCTNSSYEDMSRSASIAEEA 417 Ustilago maydis 521
NP_989519   326 qylvpdagcqyDQVIEINLSELKPHINGPFTPDLAHPVsdvgavaekEGWPVDIRVGLIGSCTNSSYEDMGRSAAVAKQA 405 chicken
O13966      320 piiaadenahyDQIIEIDLNTLEPHLNGPFTPDLATPIskfkeavkkNDWPQELKVGLIGSCTNSSYEDMSRAASICQQA 399 fission yeast
AAF01428    327 nlvpdegllkyDQLIEINLDELKPHINGPFTPDLANPVwevgavaeqKGWPLDIRVGLIGSCTNSSYEDMGRAAAVARQA 406 African clawed frog
P49609      322 eqlradenavyDQLIEINLSELEPHINGPFTPDLAHPLskfkeevekNGWPAELTVGLIGSCTNSSYEDMARSASVVKQA 401 Gracilaria gracilis
CAC18623    349 fkfkadegaqyDELIEIDLSKLEPHINGPFTPDLSIPLsefkktvqeQKWPEKLSAGLIGSCTNSSYEDMTRCESIVKAA 428 Neurospora crassa
CAB93521    332 kilsadknceyDELIEINLDTLEPHVNGPFTPDLGHPIsklgenskkNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDA 411 fruit fly
Feature 1                                                   #  ##                     #         
1AMI        377 LAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQWDrk-diKKGEKNTIVTSYNRNFTGRNDA 455 cow
ZP_00116914 378 IAKGLVTKAEFGINPGSEQVRYTADRDGLLGTFTDLNAKIFTNACGPCIGMWDrv-gaEKKEKNTIVHSFNRNFAKRADG 456 Cytophaga hutchi...
P34455      401 LDKGLKAKTIFTITPGSEQVRATIERDGLSKIFADFGGMVLANACGPCIGQWDrq-dvKKGEKNTIVTSYNRNFTGRNDA 479 nematode
NP_944590   406 LDKGLKCKAQFTVTPGSEQIRATIERDGYAKVLRDVGGIVLANACGPCIGQWDrr-dvKKGEKNTIVTSFNRNFTARNDA 484 zebrafish
P19414      401 AAHGLKSKTIFTVTPGSEQIRATIERDGQLETFKEFGGIVLANACGPCIGQWDrr-diKKGDKNTIVSSYNRNFTSRNDG 479 baker's yeast
YP_003633   378 ADKNLEVKAEYTVTPGSEMIRYTIERDGLIKTFSDIGGVVLANACGPCIGQWSrh-tkDPERKNSIITSFNRNFAKRNDG 456 Leptospira inter...
EAK83948    418 AAHGLKVKSKFTITPGSEQIRATIERDGQMEILEKAGGMVLANACGPCIGQWDrk-diKKGDKNSIITSYNRNFTGRNDA 496 Ustilago maydis 521
NP_989519   406 LAHGLKCKSKFTITPGSEQIRATIERDGYAQILRDVGGLILANACGPCIGQWDrk-diKKGEKNTIVTSYNRNFTGRNDA 484 chicken
O13966      400 IDKGIKTKSLFTITPGSEQVRATLTRDGQLDTMRKAGGIVLANACGPCIGQWKrt-dvKKGEKNSIVTSYNRNFTGRNDA 478 fission yeast
AAF01428    407 LDHGLKCKSQFTITPGSEQIRATIERDGYAAVLRDVGGVVLANACGPCIGQWDrk-diKKGEKNTIVTSYNRNFTGRNDA 485 African clawed frog
P49609      402 LSHGVKSKSIFNITPGSEQVRATISRDGILDTFTEAGGTVLANACGPCIGQWNrs-dvPKGTPNSIITSFNRNFSQRNDG 480 Gracilaria gracilis
CAC18623    429 EQAGIKPASDFYITPGSEGIRATLERDNTLQTFEKAGGIVLSNACGPCIGQWKrqddiPKGTPNAILTSYNRNFRGRNDG 508 Neurospora crassa
CAB93521    412 MSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDrk-dvKKGDKNTIVTSYNRNFTGRNDA 490 fruit fly
Feature 1                              
1AMI        456 NPETHAFVTSPEIVTALAIAGTL 478 cow
ZP_00116914 457 NPNTFAFVASPEMVAAIAIAGDL 479 Cytophaga hutchinsonii
P34455      480 NPATHGFVTSPDITTAMAISGRL 502 nematode
NP_944590   485 NPATHAFVTSPEIVTALAIAGTL 507 zebrafish
P19414      480 NPQTHAFVASPELVTAFAIAGDL 502 baker's yeast
YP_003633   457 LAGTHAFVASPEIVTAFAIAGKL 479 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
EAK83948    497 NPATHAFVASPDLVTAMAFAGRL 519 Ustilago maydis 521
NP_989519   485 NPETHAFVTSPEIVTALSIAGTL 507 chicken
O13966      479 NPATHAFVTSPDIVTAMVFSGDM 501 fission yeast
AAF01428    486 NPETHAFVTSPEIVTALSIAGTL 508 African clawed frog
P49609      481 NPQTHAFVASPEIVTAMSLAGSL 503 Gracilaria gracilis
CAC18623    509 NLETMNFLASPEIVTAMAYAGST 531 Neurospora crassa
CAB93521    491 NPATHCFVTSPELVTALSIAGRL 513 fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap