Conserved Protein Domain Family
rbcL

?
CHL00040: rbcL 
ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
Statistics
?
PSSM-Id: 176981
View PSSM: CHL00040
Aligned: 178 rows
Threshold Bit Score: 974.181
Threshold Setting Gi: 269101141
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11467508    1 MSQSVSERTRIKsdrYESGVIPYaKMGYWDASYTVQDTDVLALFRITPQPGVDPVEAAAAVAGESSTATWTVVWTDLLTA 80 
11465475    1 MAQSVQERTRLKnkrYESGVIPYaKMGYWDPNYVVKDTDILALFRVTPQPGVDPIEASAAVAGESSTATWTVIWCDLLTA 80 
51210006    1 MSQSVEERTRIKnqrYESGVIPYaKMGYWDPNYVVKETDVLALFRVTPQPGVDPVEASAAVAGESSTATWTVVWTDLLTA 80 
11465692    1 MSQSVESRTRIKserYESGVIPYaKMGYWDADYVIKETDILALFRITPQPGVDPIEASAAIAGESSTATWTVVWTDLLTA 80 
90994417    1 MSQSVESRTRIKserYESGVIPYaKMGYWDADYVIKETDILALFRITPQPGVDPIEASAAFAGESSPATWTVVWTDLLTA 80 
71842225    1 MSQAVESRTRIKserYESGVIPYaKMGYWDPEYVIKDTDILALFRCTPQPGVDPVEAAAALAGESSTATWTVVWTDLLTA 80 
283794867   1 MSQSVETRTRIKnerYESGVIPYaKMGYWDADYSIKDTDILAMFRMTPQKGVDPIECAAAIAGESSTATWTVVWTDLLTA 80 
30468058    1 MAQSVQERTRLKnkrYESGVIPYaKMGYWNPNYVVKDSDMLALFRVTPQPGVDPIEAAAAVAGESSTATWTVVWTDLLTA 80 
11467653    1 MSQSVESRTRIKnerYESGVIPYaKMGYWDADYVIKDTDVLAMFRMTPQKGVDPVECAAAIAGESSTATWTVVWTDLLTA 80 
242624313   1 MSQSVSERTRIKserYESGVIPYaKMGYWDSSYTIKTTDLLALFRITPQPGVDPVEAAAAVAGESSTATWTVVWTDLLTA 80 
11467508   81 CERYRAKAYRVDPVPNTTDQYFAFIAYECDLFEEGSLANLTASIIGNVFGFKAVAALRLEDMRIPYAYLKTFQGPATGIV 160
11465475   81 CDVYRAKAYRVDQVPNSPDQYFAYIAYDLDLFEEGSIANLTASIIGNVFGFKALAALRLEDMRIPIGYLKTFQGPATGVV 160
51210006   81 CDLYRAKAYKVDAVPNTTDQYFAFIAYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGLI 160
11465692   81 CDLYRAKAYRVDPVPNVADQYFAYIAYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRMPVAYLKTFQGPATGLI 160
90994417   81 CDLYRAKAYRVDPVPNVADQYFAYIAYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRMPVAYLKTFQGPATGLI 160
71842225   81 CDLYRAKAFRVDPVPSAADTYFCYIAYDIDLFEEGSLANLTASIIGNIFGFKAVKALRLEDMRFPVALLKTYQGPATGVV 160
283794867  81 CDLYRAKAYRVDPVPGAVDQYFAYIAYELDLFEEGSLANLTASIIGNVFGFKAVNALRLEDMRIPVAYLKTFQGPATGVV 160
30468058   81 CDVYRAKAYRVDPVPTAPDQYFVYIAYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRIPFSYLKTFQGPATGVI 160
11467653   81 CDLYRAKAYRVDPVPGATDQYFAYIAYELDLFEEGSLANLTASIIGNVFGFKAVNALRLEDMRLPIAYLKTFQGPATGVI 160
242624313  81 CDVYRAKAYRVDPVPSAADQFFAYIAYEGDLFEEGSLANMTASIIGNVFGFKAVKALRLEDMRIPHSYLKTFQGPATGVI 160
11467508  161 VERERLNKYGAPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYCLEGINRASAATGEVK 240
11465475  161 VERERLNMFGKPFLGATVKPKLGLSSKNYGRVVYEGLKGGLNFLKDDENINSQPFMRWRERFLYVMEGVNRASAATGEIK 240
51210006  161 VERERMDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWKERFLYSMEAVNRAIAATGETK 240
11465692  161 VERERMDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYSMEGVNKASAAAGEIK 240
90994417  161 VERERMDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYSMEGVNKASASAGEIK 240
71842225  161 VERERMDKFGRPLLGATVKPKLGLSGKNYGRVVFEGLKGGLDFLKDDENINSQPFMRYRERFLYSMEGVNHAACLTGEVK 240
283794867 161 VERERLDKYGRPLLGATVKPKLGLSGRNYGRVIYEGLKGGLDFLKDDENINSQPFMRWRERFLFGIEGVSRASASSGEVK 240
30468058  161 VERERLNKFGRPLLGCTVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRDRYLYVMEGVNRAAAASGEVK 240
11467653  161 VERERLDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWKERFLFGIEGVNRAAAAAGEVK 240
242624313 161 VERERLDTFGRPLLGATVKPKLGLSGKNYGRVVFEGLKGGLDFLKDDENINSQPFMRWRERFLYCIEGINRAVSVTGEVK 240
11467508  241 GSYLNITAATMEEVYKRADYAKQIGSVIVIIDLVMGYTAIQSAAIWARDNDMLLHLHRAGNSTYARQKNHGINFRVICKW 320
11465475  241 GSYLNVTAATMEEMYNRAACAKEVGSIIIMIDLVIGYTAIQSMAIWARENNMILHLHRAGNSTYARQKNHGINFRVICKW 320
51210006  241 GHYMNVTAATMEEMYERAEFAKQLGSIIIMIDLVIGYTAIQTMAIWARKNDMILHLHRAGNSTYSRQKIHGMNFRVICKW 320
11465692  241 GHYLNVTAATMEDMYERAEFSKVVGSIICMIDLVIGYTAIQSMAIWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKW 320
90994417  241 GHYLNVTAATMEDMYERAEFSKEVGSIICMIDLVIGYTAIQSMAIWARKHDMILHLHRAGNSTYSRQKNHGMNFRVICKW 320
71842225  241 GHYLNTTAATMEDMYERANFARDLGSVIVMIDLVIGYTAIQSMGKWSRDNDVILHLHRAGNSTYSRQKNHGMNFRVICKW 320
283794867 241 GHYFNITAGTMEDMYERANFAKEIGSVICMIDLVIGYTAIQSMAIWARKNSMILHLHRAGNSTYSRQKIHGMNFRVICKW 320
30468058  241 GSYLNVTAATMEECYKRAEFAKEVGSVIIMIDLVIGYTAIQTMAIWARENNMILHLHRAGNSTYSRQKNHGINFRVISKW 320
11467653  241 GHYFNVTAGTMEDMYERAEFCKEIGSVICMIDLVIGYTAIQSMAIWARKNSMILHLHRAGNSTYSRQKTHGMNFRVICKW 320
242624313 241 GSYLNITAGTMEEMYTRAEYAKELGSIIVMIDLVIGYTAIQSMAIWARNNDMVLHLHRAGNSTYARQKTHGINFRVICKW 320
11467508  321 MRMSGVDHIHAGTVVGKLEGDPLMIKGFYDVLRLTTLDVNLPYGIFFDMSWASLRKCMPVASGGIHCGQMHQLIHYLGDD 400
11465475  321 MRMAGVDHIHAGTVVGKLEGDPIIVKGFYNTLLLPKLDVNLPQGLFFEMDWASLRKTVPVASGGIHAGQMHLLLKYLGDD 400
51210006  321 MRMSGVDHIHAGTVVGKLEGDPLMIRGFYNTLLQTHLEVNLPQGIFFEQDWASLRKVTPVASGGIHCGQMHQLLDYLGND 400
11465692  321 MRMAGVDHIHAGTVVGKLEGDPLMIKGFYNTLLAGETEINLPQGLFFAQNWASLRKVVPVASGGIHAGQMHQLLDYLGDD 400
90994417  321 MRMAGVDHIHAGTVVGKLEGDPLMIKGFYNTLLESDTDINLPQGLFFAQNWASLRKVVPVASGGIHAGQMHQLLDYLGDD 400
71842225  321 MRMSGCDHIHAGTVVGKLEGDPLMIKGFYNTLLDTKTEVNLPQGLFFAQDWASLRKCVPVASGGIHCGQMHQLINYLGDD 400
283794867 321 MRMAGVDHIHAGTVVGKLEGDPLMVKGFYNVLLRTKLDVNLPQGLFFSQDWASLAKCMPVASGGIHCGQMHQLIHYLGDD 400
30468058  321 MRMAGVDHIHAGTVVGKLEGDPIIIKGFYNTLLLPKLEVNLPQGLFFEMDWASLRKTLPVASGGIHAGQMHQLLHYLGED 400
11467653  321 MRMAGVDHIHAGTVVGKLEGDPLMVKGFYNTLLETQTDVNLVQGLFFAQDWAALNKCMPVASGGIHCGQMHQLINYLGDD 400
242624313 321 MRMAGVDHIHAGTVVGKLEGDPLMVQGFYDTLLLTHLKIDLPKGIFFDMDWASLRKCMPVASGGIHCGQMHQLLNYLGDD 400
11467508  401 VVLQFGGGTIGHPDGIQAGATANRVALEAMVLARNEGADYFNPqvGPQILREAAKKCGPLQTALDLWKDISFNYTSTDTA 480
11465475  401 VVLQFGGGTLGHPDGIQAGATANRVALEAIVLARNEGRDYVNE--GPQILKEAARTCGPLQTSLDLWKDISFNFTSTDTA 478
51210006  401 VVLQFGGGTIGHPDGIQAGATANRVALEAMVLARNEGRDYVAE--GPQILRDAAKTCGPLQTALDLWKDITFNYTSTDTA 478
11465692  401 VVLQFGGGTIGHPDGIQAGATANRVALESMVMARNEGRDFVAE--GPQILRDAAKTCGPLQTALDLWKDISFNYTSTDTA 478
90994417  401 VVLQFGGGTIGHPDGIQAGATANRVALESMVMARNEGRNYVAE--GPQILRDAAKTCGPLQTALDLWKDISFNYTSTDTA 478
71842225  401 VVLQFGGGTIGHPDGIQAGATANRVALECMVLARNEGRDYIAE--GPQILRDAAKTCGPLQTALDLWKDITFNYASTDTA 478
283794867 401 VVLQFGGGTIGHPDGIQAGATANRVALECMILARNEGRDYLAE--GPTILKNAAKTCGPLQTALDLWKDITFNYASTDTA 478
30468058  401 VVLQFGGGTIGHPDGIQAGATANRVALEAMVLARNEGRDYFNE--GPQILRDAAKNCGPLQTALDLWKDIAFNYTSTDTS 478
11467653  401 VVLQFGGGTIGHPDGIQAGATANRVALECMVVARNEGRDYVTE--GPQILRNAAKSCGPLQTALDLWKDITFNYASTDTA 478
242624313 401 VVLQFGGGTIGHPDGIQAGATANRVALEAMVLARNEGRNYVEE--GPQILRDTAKMCGPLQTALDLWKDISFNYASTDTA 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap