Conserved Protein Domain Family
PRK06223

?
PRK06223: PRK06223 
malate dehydrogenase; Reviewed
Statistics
?
PSSM-Id: 180477
View PSSM: PRK06223
Aligned: 270 rows
Threshold Bit Score: 369.073
Threshold Setting Gi: 300709524
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148264247   3 RKKISLIGG-GQIGGVLAQLSALRELG-DVVLFDI--VEGLPQGKTLDIAEASPVDNFDVALSGanDYADIKGSDIVIVT 78 
169236915   1 MTKVSIVGAaGTVGAAAGYNLALRDVVdELVFVDIpdKEEETIGQAADANHGVAYDANTDVVQG--DYADTAGSDVVVIT 78 
222481053   1 MTKVSVIGAaGTVGAAAGYNLALRDVVdELVFVDIpdQRETTIGQAADTNHGVAYDSNTAVRQG--DYEDTAGSDVVVIT 78 
257386868   1 MTKVSVVGAaGTVGAAAGYNIALRDIAdELVYVDIpdQEDVTIGQAADTNHGVAYDSNTTIRQG--TYEDTAGSDVVVIT 78 
284166984   1 MTKVSVVGAaGTVGAAAAYNIALRDIAdELVLVDIpdKEDDTIGQAADVNHGAAYDSNTTIRQG--GYEDTAGSDVVVIT 78 
289581641   1 MTKVSVVGAaGTVGAAAGYNIALRDIAdELVFVDIpdKEDDTIGQAADANHGAAYDSNTTIRQG--GYEATEGSDVVVIT 78 
292657115   1 MTKVSVIGAaGTVGAAAGYNLALRDVCdELVFVDIpkMEDKTVGQAADTNHGIAYDSNTVVTQG--GYEDTAGSDVVVIT 78 
55379330    1 MTKVSVVGAaGTVGAAAGYNIALRDIAdEVVFVDIpdKEDDTVGQAADTNHGIAYDSNTRVRQG--GYEDTAGSDVVVIT 78 
76800901    1 MTKVSIIGAaGTVGAAAGYNIALRDIAdELVFVDIpdQRETTIGQAADANHGIAYDSNTTVVQG--EYEDTAGSDVVVIT 78 
110669329   1 MTKVSVVGAaGTVGAAAGYSLALRGTVdELVFVDIpdKEDETIGQAADTNHGIAYDSNTTVIQG--DYADTAGSDVVVIT 78 
148264247  79 AGLPRKPGMSRDDLIATNAKIMQSVSEGIKQYAPNAFVIVISNPLDAMVTLCQKITGFPSNRVMGMAGVLDSARFAAFIA 158
169236915  79 AGIPRQPGQSRTDLAGDNAPIMEDIGSSLAEHNDDFVTVTTSNPVDLLNRHLYESGDRDRHSVVGFGGRLDSARFRYVLG 158
222481053  79 AGIPRKEGQTRIDLAGNNAPIMEDIGSSLAEHNDDFVTVTTSNPVDLLNRHLYEAGDRDRGQVIGFGGRLDSARFRYVLS 158
257386868  79 AGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEHNDDFVTITTSNPVDLLNRHLYETGDRAREKVIGFGGRLDSARFRYVLA 158
284166984  79 AGIPRQPGQTRIDLAGDNAPIMEDIGSSIAEHNDDFVTVTTSNPVDLLNRHLYETGDRAREKVIGFGGRLDSARFRYVIS 158
289581641  79 AGIPRQPGQTRIDLAGDNAPIMEDIGSSIAEYNDDFITVTTSNPVDLLNRHLYEAGNRARDKVIGFGGRLDSARFRYVIS 158
292657115  79 AGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEYNDDFVSITTSNPVDLLNRHLYETGDRDRHKVIGFGGRLDSARFRYVLS 158
55379330   79 AGIPRQPGQTRIDLAGDNAPIMEDIQSSLDEHNDDYISLTTSNPVDLLNRHLYEAGDRSREQVIGFGGRLDSARFRYVLS 158
76800901   79 AGIPRKEGQTRIDLAGDNAPIMEDIGASLDEYNDDYVSITTSNPVDLLNRHLYEAGDRDRHKVIGFGGRLDSARFRYVLS 158
110669329  79 AGIPRSPGQTRIDLAGDNAPIMADIGSSLAAHNEEFVSITTSNPVDLLNRHLYETGDRERHTVIGFGGRLDSARFRYVLS 158
148264247 159 WELGVSVKDVNAMVLGGHGDTMVPIIRYANVNGVPVMellerkynndkaKAKEVMAALVKRTQGAGGEVVGllKTGSAFY 238
169236915 159 QRFDVPVQNVDATILGEHGDAQVPVFSKVRVNGTDPA------------FSADEREEILADLQESAMNVIE--KKGATQW 224
222481053 159 QRFDAPVKNVEATILGEHGDAQAPVFSKVRVDGRDPS------------FDADEKEEIVEDLQESAMDVIS--RKGATQW 224
257386868 159 ERFDTEVQNVEATILGEHGDAQVPVFSKVRIDGADPD------------FSADEKEAILGELQESAMDVIE--RKGATEW 224
284166984 159 QRFDAPVQNVEATILGEHGDAQVPVFSKVRVDGQDPE------------FDEDEKDDLLEELQTSAMNVIE--KKGATQW 224
289581641 159 QRYDVPVQNVEATILGEHGDAQVPVFSKVRVNGQDLE------------FTDDEKDELLEELQTSAMNVIE--KKGATEW 224
292657115 159 QRFDVPVKNVDATILGEHGDAQVPVFSKVRVDGNDPA------------FSADEKEEILGDLQESAMDVIE--RKGATQW 224
55379330  159 EEFDAPVQNVEGTILGEHGDAQVPVFSKVRVDGTDPE------------FSGDEKEQLLGDLQESAMDVIE--RKGATEW 224
76800901  159 ERFDVPVQNVEATILGEHGDAQVPVFSKVRVDGADPE------------FDGDEKEEILGDLQESAMDVIS--RKGATQW 224
110669329 159 ERFDTAVQNVEATILGEHGDAQVPAFSKVRIDGTDPT------------FDSDERETILSDLQASAMDVIE--RKGATQW 224
148264247 239 SPASSAIAMAESILRDQKRLLPVCALLNGEFGVKGYYVGVPCILGSNGIEKIVEFSLDAEEQAMFDNSVAAVKELVDSMK 318
169236915 225 GPATGVAHMVEAILNDTGEVLPGSMVLDGEYGLDDVGLGVPVKLGSDGVEEVVEWELTADERDLLDEAAEKLSAQYDEIA 304
222481053 225 GPATGVAHTVEAVLNDTGEVLPCSVVLDGEFGYEDTAFGVPAKLGSNGVEEVVEWELDEYESDLLDEAAEKLSEQYEKIA 304
257386868 225 GPATGVAHMVEAVLRDTGEVLPGSVVLDGEFGHEGTAFGVPVKLGSDGVEEVVEWDLDDYEQDLMAEASEKLAEQYDKIG 304
284166984 225 GPATGVGHTVEAIVRDTGEVLPCSVKLEGEYGQEDTAFGVPVKLGSDGVEEIVEWDLTEYERNQLGEAAEKLSEQYDKIS 304
289581641 225 GPATGVGHMVEAILRDTGEVLPASVTLEGEFGHEDTAFGVPVKLGSNGVEEVVEWDLTEYERNQLGEAAEKLSDQYDKIA 304
292657115 225 GPATGVAHMVEAVLHDTGEVLPGSLVLDGEFGYEDTAFGVPVKLGSNGIEEVVEWDLDDYEADLMDDAAEKLRDQYDEIA 304
55379330  225 GPARGVAHMVEAILHDTGEVLPASVKLEGEFGHEDTAFGVPVRLGSNGVEEIVEWDLDDYEQDLMADAAEKLSDQYDKIS 304
76800901  225 GPATGVAHMVEAVLNDTGEVLPGSLVLDGEYGYEDTAFGVPVKLGANGIEEVVEWDLDDYESELMDDAAEKLSDQYDKIS 304
110669329 225 GPATGVAHMVEAVLNDTGEVLPGSVVLDGEYGYTDTAFGVPVKLGANGVEEVLEWELDQYEHELMDDAAEKLSDQYAKI- 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap