Conserved Protein Domain Family
PRK10262

?
PRK10262: PRK10262 
thioredoxin reductase; Provisional
Statistics
?
PSSM-Id: 182343
View PSSM: PRK10262
Aligned: 63 rows
Threshold Bit Score: 609.755
Threshold Setting Gi: 161503916
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157146425   1 MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFDTEI 80 
283784710   1 MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEI 80 
296103106   1 MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI 80 
146311069   1 MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPHDLTGPLLMERMHEHATKFDTEI 80 
288936309   1 MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI 80 
152969477  10 MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI 89 
206579723   1 MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI 80 
161503916   1 MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAEKFATEI 80 
194735517   1 MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI 80 
156934617   1 MGTAKHSKLLILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPHDLTGPLLMERMHEHAAKFETEI 80 
157146425  81 IFDHINSVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
283784710  81 IFDHINKVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
296103106  81 LFDHINKVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
146311069  81 LFDHINKVDLQNRPFRLTGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
288936309  81 IFDHISRVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
152969477  90 IFDHISRVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 169
206579723  81 IFDHISRVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
161503916  81 IFDHINSVDLQNRPFRLKGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
194735517  81 IFDHINKVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
156934617  81 LFDHINKVDLQNRPFRLIGDSGEYTCDALIIATGASARYLGLPSEEAYKGRGVSACATCDGFFYRNQKVAVIGGGNTAVE 160
157146425 161 EALYLANIAAEVHLIHRRDGFRAEKILIKRLMDKVENGNIVLHTHRTLEEVTGDQMGVTGLRLRDTQNPDNIESLDVAGL 240
283784710 161 EALYLANIASEVHLIHRRDTFRAEKILIKRLMDKVENGNIVLHTHRTLEEVTGDQMGVTGLRLRDTQNADNIEALDVAGL 240
296103106 161 EALYLANIASEVHLIHRRDTFRAEKILIKRLMDKVASGNIVLHTNRTLEEVTGDQMGVAGLRIRDTQNTDNVETLEVAGL 240
146311069 161 EALYLANIASEVHLIHRRDTFRAEKILIKRLMDKVASGNIVLHTHRTLEEVTGDQMGVSGLRLRDTQNSDNVESLEVAGL 240
288936309 161 EALYLSNIASEVHLIHRRDAFRAEKILIKRLMDKVASGNIVLHTDRTLEEVTGDQMGVSGLRLRDTKNSDNVESLEVAGL 240
152969477 170 EALYLSNIASEVHLIHRRDSFRAEKILIKRLMDKVASGNIVLHTDRTLEEVTGDQMGVSGLRLRDTKNSDNVESLEVAGL 249
206579723 161 EALYLSNIASEVHLIHRRDAFRAEKILIKRLMDKVASGNIVLHTDRTLEEVTGDQMGVSGLRLRDTKNSDNVESLEVAGL 240
161503916 161 EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIVLHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL 240
194735517 161 EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL 240
156934617 161 EALYLANIASEVHLIHRRDTFRAEKILVKRLMDKVESGNIVLHTHRTLEEVTGDQMGVSGLRLRDTVNPENVETLDVAGL 240
157146425 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSVPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 320
283784710 241 FVAIGHSPTTAIFEGQLELENGYIKVQSGIHGNATQTSVPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 320
296103106 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLAEQ 320
146311069 241 FVAIGHSPNTGIFDGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLAEL 320
288936309 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 320
152969477 250 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 329
206579723 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 320
161503916 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDSLADT 320
194735517 241 FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA 320
156934617 241 FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLAEK 320
157146425 321 C 321
283784710 321 C 321
296103106 321 G 321
146311069 321 S 321
288936309 321 C 321
152969477 330 C 330
206579723 321 C 321
161503916 321 S 321
194735517 321 S 321
156934617 321 Q 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap