Conserved Protein Domain Family
PTZ00017

?
PTZ00017: PTZ00017 
histone H2A; Provisional
Statistics
?
PSSM-Id: 185399
View PSSM: PTZ00017
Aligned: 30 rows
Threshold Bit Score: 196.89
Threshold Setting Gi: 237844891
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66357734   18 VGGKGKAGSGKgSKKQPTSRAARAGLQFPVGRIQRMLKHRIPGDcRVGSTASVYAAAILEYLTAEVLELAGNASKDLKVK 97 
71031070   20 KGGKGKTGSGK-GKKTPMSRAARAGLQFPVGRVHRMLKSRVSADgRVGSTAAVYASAILEYLTAEVLELAGNASKDLKVK 98 
124505075  25 KGGKGKTGSGK-TKKAPLSRASRAGLQFPVGRVHRMLKSRISSDgRVGSTAAVYAAAILEYLTAEVLELAGNATKDLKVK 103
84994758   20 KGGKGKTGSGK-GKKTPMSRAARAGLQFPVGRVHRMLKSRVSADgRVGSTAAVYASAILEYLTAEVLELAGNASKDLKVK 98 
156096941  25 KGGKGKTGSGK-TKKAPLSRASRAGLQFPVGRVHRMLKTRISSDgRVGSTAAVYAAAILEYLTAEVLELAGNATKDLKVK 103
156085509  24 KGGKGKAGAGK-GKKTPMSRAARAGLQFPVGRVHRMLKSRISADgRVGSTAAVYTSAILEYLTAEVLELAGNASKDLKVK 102
209875863  22 VGGKGKAGSGKgSKKQPTSRAARAGLQFPVGRIQRMLKTRIPCDcRVGSTASVYAAAIMEYLTAEVLELAGNASKDLKVK 101
237831941   1 MSAKGKGGRAK-KSGKSSSKSAKAGLQFPVGRIGRYLKKGRYAK-RVGAGAPVYMAAVLEYLCAEILELAGNAARDHKKT 78 
237831985   1 MSAKGAGGRKKtSSGKKVSRSAKAGLQFPVSRIGRYLKKGRYAK-RVGVGAPVYLAAVLEYLCAEILELAGNAARDHKKT 79 
67624387   18 VGGKGKAGSGKgSKKQPTSRAARAGLQFPVGRIQRMLKHRIPGDcRVGSTASVYAAAILEYLTAEVLELAGNASKDLKVK 97 
66357734   98 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIEKSLMGKALIGKKGKKGNMS 151
71031070   99 RITPRHLQLAIRGDEELDTLV-KATIAGGGVIPHIHKALMNKGPAPVLVKPPKRL 152
124505075 104 RITPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKALMNKVPLPPTAQKKPKK 157
84994758   99 RITPRHLQLAIRGDEELDTLV-KATIAGGGVIPHIHKALMNKGPQPVLVKPPKRL 152
156096941 104 RITPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKALMNKVPVPPTQAKKPKK 157
156085509 103 RITPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKALMNKVPPQVLVKPPQPQ 156
209875863 102 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIEKSLMSKTLMGKKGKKGMSP 155
237831941  79 RIIPRHIQLAVRNDEELSKFLgGVTIASGGVMPNVHSVLLPKKSKGKKSQ----- 128
237831985  80 RIIPRHIQLAVRNDEELSKFLgGVTIANGGVMPHVHAVLLPKHSKSKGKHGVSQE 134
67624387   98 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIEKSLMGKALIGKKGKKGNMS 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap