Conserved Protein Domain Family
PTZ00335

?
PTZ00335: PTZ00335 
tubulin alpha chain; Provisional
Statistics
?
PSSM-Id: 185562
View PSSM: PTZ00335
Aligned: 49 rows
Threshold Bit Score: 739.984
Threshold Setting Gi: 118396516
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66806671    2 GREIISIHIGQAGVQVGNSCWELYCLEHGIERDGSIP-ADRK-QSSDvnnlNKDLGTFFSESTNGkKVVPRAIFLDLEPT 79 
71032419    1 MREVIAIHVGQAGVQLGSSVWELFCAEHGVKPDGTTEkVSKSkKDEE----GAAFHTFFSESESG-RQVPRCVFVDLEPS 75 
84999372    1 MREIIAIHVGQAGVQLGSSVWELFCAEHGVRPDGSTEiVDKNnKGEE----SNAFHTFFSESQSG-RQVPRCVFVDLEPS 75 
66812608    1 MREIISIHIGQAGIQVGNSCWELYCLEHGIDKDGTFK-KDYK-RGN-----DVKYETFFRESSTKdKVVPRSLFIDLEPT 73 
145484487   1 MKEVISIHVGQGGIQLGDSCWEQLCLEHGIQPNGLMQ---REiSNQE----DSEFYKFYSENSKG-NFVPRSLFIDSESE 72 
145493346   1 MREIITIQVGQGGIQVGNACWELFCLEHQIQPNGQM-------INQQviekDDALRTFFSESDHQ-KLVPRSVLLDLEPT 72 
156085898   1 MREVIAVHIGQAGVQVGNAVWELFCIEHGIRPDGTVEaDPGYgAGEE----DHAFHAFFAETASG-KHVPRCLFVDLEPS 75 
237837501   1 MREIISLHIGQAGVQVGNACWELFCLEHGIGSGGRR--VDQV-NGGDfissDSSFNAFFAETAQK-QYVPRCVMVDLEPT 76 
66357386    6 MREVISIHVGQAGIQIGNACWELFCLEHGINPDGTMPmSEQN-MGIS----DDAFNTFFSETGAG-KHVPRAVFVDLEPT 79 
67594638    1 MREVISIHVGQAGIQIGNACWELFCLEHGINPDGTMPmSEQN-MGIS----DDAFNTFFSETGAG-KHVPRAVFVDLEPT 74 
66806671   80 VIDEIRTGDYKNLFHPEQLITGKEDAANNYARGHYTVGKELIDVCVDRIRRLADQCDGLQGFLVFHSVGGGTGSGFGSLL 159
71032419   76 VIDSVEKGKFGSLYHPEQLISGKEDAANNFARGHYTVGRDIYSPVMDRIRRLTDMCDSVQGFLFFSAVGGGTGSGTGSLL 155
84999372   76 VIDSVEKSRFGGLYHPEQLISGKEDAANNFARGHYTVGRDIYSPVMDRIRRLTDNCDSIQGFLFFSAVGGGTGSGTGSLL 155
66812608   74 VIDEIRSGDYRELFHPNQLINGKEDAANNYARGHYTVGKELLDLSLQRIRELTDECDGLQGFFLFHSVGGGSGSGFGSLL 153
145484487  73 AISKVKDGKYRELFSQNSFIYGKEDASNNFARGYYQIGKEYIDVSLERVRKLAEDCQSPQGILLFNSVGGGTGSGLGTLL 152
145493346  73 LINQVKTGKFKEMFKPEQFVSGKGGAAHNFGRGHYSIGREYIDICLERIRKIVDNCSSFQGFMMLNSVGGGTGSGLGTLL 152
156085898  76 VVDEVRRGAYKGLFHPEQLMSGKEDAANNFARGRYTTGADILNPAMDRIRKLSDACDSIQGFLFFSAVGGGTGSGTGSLL 155
237837501  77 VVDDVRKGSYGKLFHPDYLLSGKEDAANNFARGYYTVGREMADTVMECIRRLADNCDGLQGFLVFHAVGGGTGSGLGCHL 156
66357386   80 VVDEIRSGTYRQLFHPEQLINGKEDAANNFARGHYTVGKEILEVCLDRIRKLADNCTGLQGFLMFNAVGGGTGAGLGTLL 159
67594638   75 VVDEIRSGTYRQLFHPEQLINGKEDAANNFARGHYTVGKEILEVCLDRIRKLADNCTGLQGFLMFNAVGGGTGAGLGTLL 154
66806671  160 LQKLALDYgGKKSKLDFCVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVSFMLDNEAIYNICKNSLDIEKPTYTNLNRLIA 239
71032419  156 LENIGAEF-ERKTKLSFCIWPSPQVSTAVVEPYNSVLTTHSLLEHSDVAVVLDNEAIYGICKNNLEIGRPNYQNLNKIIA 234
84999372  156 LENIGAEF-ERKTKLSFCIWPSPQVSTAVVEPYNSVLTTHSLLEHSDVAVVLDNEAIYGICKNNLEIGRPNHENLNKIIA 234
66812608  154 LQKLASEY-GKKSKIDFCIYPSPQVSTAVVEPYNCVLSTHSLLEHCDVTFMLDNEAIYDVCKKKLHIERPSYANLNRMIA 232
145484487 153 LERLQEDY-LKQIRIGINIYPYPNNDTAIIESYNAILATQYLQKFADVCILFDNQAVYGICNNALDIQNPSYTNLNRLIA 231
145493346 153 LEKLSVDY-CKKSRLSITIYPSPETSEAMVEPYNSIFATSSLLEHSEVCIAMDNQALYDICKNGLGVETPKYSNLNRIIA 231
156085898 156 LENIGAEY-ERKTKLNFCIWPSPQVSTAVVEPYNSVLSTHSLLENTDVAVVLDNEAIYSICKKNLDIGRPIYKNLNRIIA 234
237837501 157 METLSVEF-ARKPKLNFCVWPSPQVSTSVVEPYNAVLSSHSLLEYTDVAVILDNEAVYDICRRNLDIQIPSYCDLNRIIA 235
66357386  160 LERLSVDY-GKKSKLNFCTWPSPQLSTAVVEPYNAVLSTHSLLEHADVAVMLDNEAIYDICRRNLNIEQPAYTNLNRLIA 238
67594638  155 LERLSVDY-GKKSKLNFCTWPSPQLSTAVVEPYNAVLSTHSLLEHADVAVMLDNEAIYDICRRNLNIEQPAYTNLNRLIA 233
66806671  240 QVISSLTSSLRFPGQLNLDINDIQTNLVPFPRLHFVLCSYAPVISREKAHHETITVDNITSAVFSEKNIMAKCQPNLGKY 319
71032419  235 QVISSLTTSLRFDGALNVDMSEFQTNLVPYPRIHFMLSSYSPIISKRKAKHEQMSVSEITFSAFDPKSMMAECDPRTGYY 314
84999372  235 QVISSLTTSLRFDGALNVDMGEFQTNLVPYPRIHFMLSSYSPIISKRKAKHEQMSVSEITFSAFDPKSMMAECDPRTGYY 314
66812608  233 QVISSLTSSLRFPGQLNVDINEFQTNLVPFPRIHFLLASYAPLISIENANHEQVTVSAITNSVFSNDNLLAKCDPSSGKY 312
145484487 232 QVYSSLTAAIRFNGSLYSDISEFQTNLVLHPRLHFMLCSYSPILSNYKTCFQQPITTDISIEAFEPQNMMVKCNPQKGKF 311
145493346 232 QAISSITASIRFDGALFTDITEIQTSLIPYPKLQFLICSQAPITSHQIMDNEKLSTFEITKLAFEAENMMAKCDPRQGKF 311
156085898 235 QVISSLTTSLRFDGALNVDMNEFQTNLVPYPRIHFMLSSYAPIISARKAKHEFMSVGEITNSAFDPASMMAECDPRLGHY 314
237837501 236 QVISSVTTSLRFDGALNVDMTEYQTNLVPYPRIHFLLTSYAPLLSASKYRHEQMNVREITVAAFEERNMMAKCCPSKGKY 315
66357386  239 QVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAFHEQLSVAEITNAVFEPQNQMAKCDPRHGKY 318
67594638  234 QVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAFHEQLSVAEITNAVFEPQNQMAKCDPRHGKY 313
66806671  320 MACCLMY-----------------RGDIVPKEAQKAVQNIRSEksRNVSFVDWSP-TGFKCGINNQAPVSTKDSEMAEVK 381
71032419  315 MSCCLMYsilpilpilkmvckcmcRGDVVPKDVNHAISVVKNK--KTVKFVDWSP-TGFKFGINYQPPCVVPGDDISRPS 391
84999372  315 MSCCLMY-----------------RGDVVPKDVNNAIAAVKNK--KTVRFVDWSP-TGFKFGINYQPPCVVPGDDISRPS 374
66812608  313 MSCCLLY-----------------RGNMTPNEAQTAVADIKTQksKTVNFTSWSKgTGFKCGINSSIPTVVPGGDMANIE 375
145484487 312 MACSILY-----------------RGDVIPRDVRLSLSKLSVQ--KTIQFVDWCP-TKFKVGITYKDHFIIPNGEIAKVV 371
145493346 312 LSCSLIY-----------------RGDIIPKDICYSISQIKTQ--KTIRFVDWCP-TGFRVGINYQAQQALPEDDLCKSS 371
156085898 315 MACCLMY-----------------RGDVVPKDVNSAIAHVKSK--KSVRFVDWSP-TGFKFGINYQPPCVVPGDDLAKIS 374
237837501 316 MACCLMY-----------------RGDVTPKDVNAAMGTIKSR--RDINFVDWCP-TGFKTGLNYQPPTFVPDSHLAAAP 375
66357386  319 MACCLMY-----------------RGDVVPKDTNAAVATIKTK--RTIQFVDWCP-TGFKCGINYQPPTVVPGGDLAKVM 378
67594638  314 MACCLMY-----------------RGDVVPKDTNAAVATIKTK--RTIQFVDWCP-TGFKCGINYQPPTVVPGGDLAKVM 373
66806671  382 KSVCMLSNTTAISQVFSRINHKFDLMFVKRAFVHWYVGEGMEEGEFAEARDDLLALEKDYESVSASTEGEEQEEEY 457
71032419  392 RAVCMISNSTSIAEVFTRMDKKFDLMYAKRAFIHWYVSEGMEECEFQEAREDVAALEKDYESAGSQ---------- 457
84999372  375 RAVCMISNSTSIAEVFTRMDKKFDLMYAKRAFVHWYISEGMEECEFQEAREDVAALEKDYESAGTQ---------- 440
66812608  376 KAVCLLSNTTSISQIFNRLNRKFSLMFEKRAFVHWYVGEGMEEGEFAEARDDLLALEKDYESLAEDLDDEQVEEQE 451
145484487 372 RSACMISNTTAIYDIFPKFTHAFDQMFSRRAFVHWYLKEGMEEFQFIEAREELAALEKDYEEVGSQIVDEGREGAA 447
145493346 372 RSACMIANTTALSQIFSKLSQKYDLMFAKRAFVHWYVQEGMEEAQFFEAREALAGLQKDYEEVDQNIIEEDEGA-- 445
156085898 375 RAVCMISNSTSISDVFVRMDSKFDVMYAKKAFVHWYMGEGMEESEFEEAREDVAALEKDYEEAISN---------- 440
237837501 376 RSVCMMSNSTAIKEVIQRIDIKFDKMYSKRAFVHWFVGEGMEEGQLTEARDDLAALERDYDEVASDTKMDADDEED 451
66357386  379 RACCMISNSTAIAEVFNRMDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIEIADGEDEEVH 454
67594638  374 RACCMISNSTAIAEVFNRMDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIEIADGEDEEVH 449
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap