2KG5,1X40


Conserved Protein Domain Family
SAM_Arap1,2,3

?
cd09490: SAM_Arap1,2,3 
Click on image for an interactive view with Cn3D
SAM domain of Arap1,2,3 (angiotensin receptor-associated protein)
SAM (sterile alpha motif) domain of Arap1,2,3 subfamily proteins (angiotensin receptor-associated) is a protein-protein interaction domain. Arap1,2,3 proteins are phosphatidylinositol-3,4,5-trisphosphate-dependent GTPase-activating proteins. They are involved in phosphatidylinositol-3 kinase (PI3K) signaling pathways. In addition to SAM domain, Arap1,2,3 proteins contain ArfGap, PH-like, RhoGAP and UBQ domains. SAM domain of Arap3 protein was shown to interact with SAM domain of Ship2 phosphatidylinositol-trisphosphate phosphatase proteins. Such interaction apparently plays a role in inhibition of PI3K regulated pathways since Ship2 converts PI(3,4,5)P3 into PI(3,4)P2. Proteins of this subfamily participate in regulation of signaling and trafficking associated with a number of different receptors (including EGFR, TRAIL-R1/DR4, TRAIL-R2/DR5) in normal and cancer cells; they are involved in regulation of actin cytoskeleton remodeling, cell spreading and formation of lamellipodia.
Statistics
?
PSSM-Id: 188889
View PSSM: cd09490
Aligned: 11 rows
Threshold Bit Score: 99.6771
Threshold Setting Gi: 268612044
Created: 5-Mar-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimer
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface EH [polypeptide binding site]
Evidence:
  • Comment:Highlighted residues are important for SAM_Arap3/SAM_Ship2 heterodimer formation via the end-helix (EH) surface of SAM_Arap3 (based on chemical shift perturbation, isothermal titration calorimetry, mutagenesis and molecular modeling analysis).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #                        #              ##  #      
2KG5_A         24 PQDLDIAVWLATVHLE-QYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGT 86   human
Q8BZ05          6 EVNADIRDFLMSINLE-QYLLHFREFGFYTVRDCTSINDSVLHQIGISPTGHRRRILKQLQMIF 68   house mouse
XP_001513347    6 EAHFGIQELLTSINLG-QYLPCFLESGYVTIQDCAGINNSVLLKIGVFPTGHRRRILKQLEIIS 68   platypus
1X40_A         13 EVNVDIKDFLMSINLE-QYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIIL 75   human
Q4LDD4          6 DAALSVAEWLRALHLE-QYTALFEQHGLVWATECQGLSDAGLLDMGMHLPGHRRRILAGLHRAH 68   house mouse
Q96P48          6 DAALSVAEWLRALHLE-QYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRILAGLLRAH 68   human
XP_002598301    7 VEVTSVQEWLQAIQLE-VYVQLFTNQGYTQLSDCCNLNDDTLHQIGINRPGHCRRILKHLPISY 69   Florida lancelet
XP_426346      18 GSDIDIEEFLVNINLG-QYLPNFKEHGYNVVTDCVGINNSALQQMGVLPTGHRRRILKQLDTAL 80   chicken
Q8R5G7          4 PQDLDIAVWLALVHLE-QYADTFRRHGLATAGAAQHLGHEELRHLGISATGHRKRILRLLRAGS 66   house mouse
XP_687312       8 GPCSDAEDLLASIHLE-RYLDHFRQAGFLLARDFCHVDNAALNRVGVAATGHRKRILKLVEHIQ 70   zebrafish
XP_002123067    3 SPETSVQDFLEQLKLPaKYLDNFNGNGYFSLQDCYGITEERLKDIGIVLPGHYRRLLNKIPGCT 66   Ciona intestinalis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap