2DMS,2E19,2ECB,2DMP,2DA5,3NAR,2DA1,1B72,2DA3,2DJN,2R5Y,2DMT,2DMQ,3A01,1YZ8,1JGG,1ZQ3,1IG7,2DA2,2E1O,2KT0,3A01,3D1N,2XSD,1AU7,1BW5,1OCP,1APL,1YRN,2DN0,2D5V,3NAU


Conserved Protein Domain Family
HOX

?
smart00389: HOX 
Click on image for an interactive view with Cn3D
Homeodomain
DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
Statistics
?
PSSM-Id: 197696
View PSSM: smart00389
Aligned: 283 rows
Threshold Bit Score: 32.6073
Threshold Setting Gi: 3881213
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DMS_A       7 GRRERTT--FTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 63   house mouse
Q21694     755 STKDRGSw-KIGDSEAGLNKYFAKNNKPGVRQREKIAKKLGLSERQVRNYFNKKRITER 812  Caenorhabditis elegans
O16747     118 PPGQRNSr-WPQEVNDLLAEEYKKNKTPISMDFDRLSIETGKTQRQIKQWFWRHKAKQS 175  Caenorhabditis elegans
O16749      81 KKKTDKVnlQRPDIKKALFEHFEKNPKPESESLQKISAQLGLTQQQVTGWFNRRNGTYL 139  Caenorhabditis elegans
P91547     224 NFKNKR---LSQDLVDKLQELFQINEMPGREISEQWAQQLGISLKTLNNWMQKKRSQKL 279  Caenorhabditis elegans
BAA74886  1093 PKKYEGR--SYEEKKQFLKDYFHKKPYPSKKEIELLSSLFWVWKIDVASFFGKRRYICM 1149 human
Q80VX4      69 NTTKYNS---ALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHG 124  Norway rat
NP_510356   84 IQNAYYSekYAPAIIHKLLPAFEANKNPNNDEILEIMADTGLSRKEVRRWFQWRNGTNF 142  nematode
CAA57167    74 NSIPAYN--AALDNNPLLLNTYNKFPYPTLSEITVLSAQAKYTEEQIKIWFSAQRLKHG 130  golden hamster
EDL06540   528 KGHEDDS---YEARKSFLTKYFNKQPYPTRREIEKLAASLWLWKSDIASHFSNKRKKCV 583  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap