1CEE,1DOA,1GZS,1AM4,1GRN,1KZG,1GZS,1NF3,1CF4


Conserved Protein Domain Family
Cdc42

?
cd01874: Cdc42 
Click on image for an interactive view with Cn3D
cell division cycle 42 (Cdc42) is a small GTPase of the Rho family
Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases. These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway. Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth. In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus. Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand. In addition, Cdc42 has been implicated in a number of human diseases through interactions with its regulators and downstream effectors. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 206664
View PSSM: cd01874
Aligned: 21 rows
Threshold Bit Score: 335.305
Threshold Setting Gi: 56759106
Created: 6-Jan-2012
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Rho molecules assume an active conformation when bound to GTP and inactive when GTP is hydrolyzed to GDP
  • Comment:Mg2+ ion plays a key role in bringing together the functional regions of the phosphate-binding, switches I and II
  • Citation:PMID 9545299
  • Structure:1CEE: Human Cdc42 binds GTP and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               ######          #  ## #                     ## #                      
1CEE_A      3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  human
Q01112      3 TIKCVVVGDGAVGKTCLLISYTTNKFPSDYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  fission yeast
P19073      3 TLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCF 82  baker's yeast
AAK77967    3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGEDPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  Schizophyllum commune
AAS48414    3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGEEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLICF 82  Pneumocystis carinii
AAD43792    3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYNRLRPLSYPQTDVFLVCF 82  fruit fly
AAH41193    3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  African clawed frog
NP_990379   3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  chicken
CAD48472    3 TIKCVVVGDGAVGKTCLLISYTTNKFPQEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  Ciona intestinalis
AAP22282    3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCF 82  California sea hare
Feature 1                                      # #                                        ##  
1CEE_A     83 SVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDpSTIEKLAKNkqkPITPETAEKLARDLKAVKYVECSALTQ 162 human
Q01112     83 SVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLRDDpSVQQKLARQhqhPLTHEQGERLARELGAVKYVECSALTQ 162 fission yeast
P19073     83 SVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDkVIIEKLQRQrlrPITSEQGSRLARELKAVKYVECSALTQ 162 baker's yeast
AAK77967   83 SVTSPASFENVKEKWFPEVRHHCPGVPCLIVGTQIDLRDDsQVIEKLARQkqrPVTSDQGERLARELGAVKYVECSALTQ 162 Schizophyllum commune
AAS48414   83 SVTSPASFENVREKWHPEVRHHCPGTPCLIVGTQIDLRDDpMIVEKLSRQrqtPITKELGEKLSKELGAVKYVECSALTQ 162 Pneumocystis carinii
AAD43792   83 SVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDEnSTLEKLAKNkqkPITMEQGEKLAKELKAVKYVECSALTQ 162 fruit fly
AAH41193   83 SVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDpSTIEKLAKNkqkPITPETAEKLARDLKAVKYVECSALTQ 162 African clawed frog
NP_990379  83 SVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDpSTIEKLAKNkqkPITPETAEKLARDLKAVKYVECSALTQ 162 chicken
CAD48472   83 SVVSPSSYENIKEKWVPEITHHCPKTPFLLVGTQVDLRDDaATIEKLSKNkqkAITQDMGDKLARELKAVKYVECSALTQ 162 Ciona intestinalis
AAP22282   83 SVVTPSSFENVREKWVPEITHHCQRTPFLLVGTQIDLRDDtPTVEKLAKNkqkPITADHGERLARELRAVKYVECSALNQ 162 California sea hare
Feature 1                    
1CEE_A    163 KGLKNVFDEAILAAL 177 human
Q01112    163 KGLKNVFDEAIVAAL 177 fission yeast
P19073    163 RGLKNVFDEAIVAAL 177 baker's yeast
AAK77967  163 KGLKNVFDEAIVAAL 177 Schizophyllum commune
AAS48414  163 KGLKNVFDEAIVCAL 177 Pneumocystis carinii
AAD43792  163 KGLKNVFDEAILAAL 177 fruit fly
AAH41193  163 KGLKNVFDEAILAAL 177 African clawed frog
NP_990379 163 KGLKNVFDEAILAAL 177 chicken
CAD48472  163 KGLKNVFDEAILAAL 177 Ciona intestinalis
AAP22282  163 RGLKNVFDEAILAAL 177 California sea hare

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap