1C89,3RDN,3QF6,1OPS


Conserved Protein Domain Family
Antifreeze_III

?
cd11617: Antifreeze_III 
Click on image for an interactive view with Cn3D
Type III antifreeze protein, may be specific to the Zoarcoidei
Antifreeze protein III inhibits the growth of ice crystals and protects fish from cold damage in sub-freezing temperatures.
Statistics
?
PSSM-Id: 212162
View PSSM: cd11617
Aligned: 12 rows
Threshold Bit Score: 88.6748
Threshold Setting Gi: 157832570
Created: 22-Feb-2012
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
ice binding
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:ice binding surface [chemical binding site]
Evidence:
  • Comment:The ice-binding sections specifically interact with lattice planes of ice crystals, disrupting their further growth
  • Structure:1QF6: type III antifreeze protein from Zoarces americanus interacts with water molecules
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           ## ##### ####                      #                    
1C89_A     73 KSVVANQLIPINTALTLVMMKAEEVSPKGIPSEEISKLVGMQVNRAVYLDQTLMPDMVKNYE 134 Antarctic eelpout
3RDN_A      4 ASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYE 65  Antarctic eel pout
3QF6_A      3 ASVVANQLIPINTALTLVMMRSEVVTPVGIPADDIPRLVSMQVNRAVPLGTTLMPDMVKGYP 64  ocean pout
1OPS_A      2 QSVVATQLIPMNTALTPAMMEGKVTNPIGIPFAEMSQLVGKQVNTPVAKGQTLMPNMVKTYA 63  ocean pout
ABA41377   25 ASIVANQLIPINTALTLIMMRAQVVTPLGIPAEDIPRIIGMQVNRAVALGTTLMPDMVKGYP 86  spotted wolffish
P24028      3 ASVVANQLIPINTALTLVMMRAEVVTPAGIPAEDIPRLVGLQVNRAVLIGTTLMPDMVKGYA 64  Canadian eelpout
ABA41372   25 ESVVATQLIPINTALTPIMMKGKVVTPMGIPFKEMSQIVGKQVNRAVPLGTTIMPEMVKGYA 86  ocean pout
P12100      2 KSVVASQLIPINTALTPAMMKAKEVSPKGIPAEEMSKIVGMQVNRAVNLDETLMPDMVKTYQ 63  Antarctic eelpout
BAD95787   25 ESVVATVLIPINTALTVGMMTTRVVSPTGIPAEDIPRLISMQVNQVVPMGTTLMPDMVKGYA 86  Zoarces elongatus
P12416     24 QSVVATQLIPINTALTPIMMKGQVVNPAGIPFAEMSQIVGKQVNRPVAKDETLMPNMVKTYR 85  Atlantic wolffish
P19606     24 QSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYC 85  ocean pout
BAD95785   25 ASVVATQLIPINTALTLVMMKAKVATPMGIPAEDIPRIVSMQVNQAVACGTTLMPGMVKTYT 86  Zoarces elongatus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap