1JJ7


Conserved Protein Domain Family
ABCC_TAP

?
cd03248: ABCC_TAP 
Click on image for an interactive view with Cn3D
ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C
TAP (Transporter Associated with Antigen Processing) is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Statistics
?
PSSM-Id: 213215
View PSSM: cd03248
Aligned: 6 rows
Threshold Bit Score: 380.278
Threshold Setting Gi: 5739521
Created: 21-Apr-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Comment:Walker A, Walker B, Q-loop, D-loop, and H-loop form the nucleotide binding site
  • Structure:1JJ7; Mg-ADP, 4.0A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                       ## ###                         
1JJ7_A       4 GLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQ 83   human
XP_509453  776 GSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISA 855  chimpanzee
AAP36718   463 GSLAPQDLKGIVRFQNVTFAYPTRPDSLVLQDVSFELHPGEVTALVGPCDAGKSTVVQLLLRFYQPQKGEIIVDGKCITL 542  African clawed frog
AAD50509   142 GTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQ 221  human
XP_415125  710 GSLAPDHVDGKVEFRNVTFSYRTRSATQVLQNVSFTLHPGKVTALVGPSGSGKSSCVNILENFYPLQDGQVLLDGHPINM 789  chicken
CAD87788   458 GNLMPKDLKGHVKFQKLTFSYPRRPDHNVLKDFSLELKPGQITALVGMSGGGKSTCVSLLERFYQPQQGTILLDGKPLQD 537  zebrafish
Feature 1                    #                                                                 
1JJ7_A      84 YEHRYLHRQVAAVGQEPQVFGRSLQENIAYGltqkptmee------------itaaavksGAHSFISglpq-gydtEVDE 150  human
XP_509453  856 YDHKYLHRVISLVSQEPVLFARSITDNISYGlptvpfem-------------vveaaqkaNAHGFIMelqd-gystETGE 921  chimpanzee
AAP36718   543 YKNEYYREKVSVVSQEPTLSARSLQDNIAYGmgdvslgc-------------vkeaaqtaHAHDFISemas-gyqtGAGQ 608  African clawed frog
AAD50509   222 YEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGlqsceddk-------------vmaaaqaaHADDFIQemeh-giytDVGE 287  human
XP_415125  790 YDHKYLHSVISLVSQEPVLFARSIADNISYGlasasfesvvqaaqkanahafitelqdgyHTGTNIPlfalrepweEAGE 869  chicken
CAD87788   538 YQHKYLHSKVAMVGQEPVLFSGTVRDNIAYGlqgcsmer-------------vkeaaskaNAHSFISklek-gydtDVGE 603  zebrafish
Feature 1                                  ##                                                  
1JJ7_A     151 AGSQLSGGQRQAVALARALIRKPCVLILDDATSALDans-----------------qlqVEQLLYESpery--------- 204  human
XP_509453  922 KGAQLSGGQKQRMAMARALVRNPPVLILDEATSALDaeseylknpgswpivcelslrevKHQPHRQWhestvaggasvpc 1001 chimpanzee
AAP36718   609 KGGLLSGGQKQRVALARALLRNPQILILDDATSSLDles-----------------eqkVHCAVYDGprd---------- 661  African clawed frog
AAD50509   288 KGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDv---------------------qCEQALQDWnsrg--------- 337  human
XP_415125  870 KGAQLSGGQKQRVAIARALIRTPPILILDEATSALDaes-----------------ehaIQQAIYGDlqn---------- 922  chicken
CAD87788   604 RGNLLSGGEKQRIAIARALIREPQVLILDEVTSSLDtes-----------------eqmVQQALSCCpt----------- 655  zebrafish
Feature 1                                 #                   
1JJ7_A     205 -------------------srsVLLITQHLSLVEQADHILFLEGGAI 232  human
XP_509453 1002 kpgphcprrssrpstatcrstrYSVIAHRLSTVEHAHLIVVLDKGRV 1048 chimpanzee
AAP36718   662 --------------------rtVLLISHRINTVQRADRILVLEGGRI 688  African clawed frog
AAD50509   338 -------------------drtVLVIAHRLQTVQRAHQILVLQEGKL 365  human
XP_415125  923 --------------------htVLVIAHRLSTVEKAHNIIVLDKGRV 949  chicken
CAD87788   656 --------------------qtLLVIAHRLKTIERADQIVVIDSGEL 682  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap