Conserved Protein Domain Family
ND3

?
MTH00148: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 214433
Aligned: 66 rows
Threshold Bit Score: 82.598
Threshold Setting Gi: 18249929
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238908490  27 SGVFYMCFIFLMTLGLLFLGMAVGQKWRYEVAKLTAFECGFDPLSSSRMP--FSMRFFLVALLFLVFDVEMVLLFPYIIS 104
153123684   1 MFWLVLLICTVIVAALGGLSHWLSHLWVRDSQKASPYECGFDPFSSSRSP--FSVRFYMVAILFLVFEVESLLFFSALHA 78 
62161124    2 VMGLSVVFVCIVCCLFTGLFMMLSEKRGLDREKCSPYECGFEPIGSARSP--FSIRFFLVAVLFVVFDVEVVLLMPFAYM 79 
51830034    2 VMGLSVVFVCIVCCLFTGLFMMLSEKRGLDREKCSPYECGFEPIGSARSP--FSIRFFLVAVLFVVFDVEVVLLMPFAYM 79 
68989143    3 FEVMSFIILVSAAPVAVSSVLVNMGESQHDWDKSAPYECGF---IGATNPgdFSSRFFHLVILFLVWDVEIVLLIPCFQD 79 
168487814   3 ILWLVLLVGGALVSSMALWSWWLMGFWFSDSQKTSPYECGFDPFSSARSP--FSVRFFMVAILFLVFEVESLMFFPLLHG 80 
168487820   3 IFWVVLFVGLCLVVAMAVQTFWLTKLWFRDSQKASPYECGFDPFGSARAP--FSVRFYMVAILFLVFEVESLMFFPVLQA 80 
229328228   3 LELIFLVMTLSLAPIMVSLSLLNFEEDYYDWDKSSPYECGF---VGPKVPgdFSSRFFHLVILFLVWDVEIVLLIPCLQD 79 
254033639   1 MFWLVLLICTVIVAALGGLSHWLSHLWVRDSQKASPYECGFDPFSSSRSP--FSVRFYMVAILFLVFEVESLLFFSALHA 78 
292496241   3 FGVVMIMMILSVAPVIFTCWFSGLPKEGYDWDKSSPYECGF---ISVKNPgdFSSRFFHLVILFLVWDVEIVLLVPCFQD 79 
238908490 105 LKMVFLkMSMLskcmCFMFLLILIVGLAHEVNEGSLEWKY 144
153123684  79 YCVGVEdVGMY----SWGFLVLLVLGLAYELFRGALQWSK 114
62161124   80 FFYGKS-VLGIl--sSSGFLLILFVGLYHEYREGSLEWVG 116
51830034   80 FFYGKS-VLGIl--sSSGFLLILFVGLYHEYREGSLEWVG 116
68989143   80 LT-----VWSSsggaLAVFLLVLSYGLYYEIFEGSVKWTL 114
168487814  81 YCSGVEnFGv----qGWAFLLVLSVGLFYELWRGALEWSR 116
168487820  81 YKEGAKsFGIY----SWGFLLILTLGLFVELYRGALEWAR 116
229328228  80 LS-----VWSSggvpLIVFMLILAYGLYYELMDGSIKWTH 114
254033639  79 YCVGVEdVGMY----SWGFLVLLVLGLAYELFRGALEWSK 114
292496241  80 LF-----GWSPegvgALLFVLILVYGLYYEMMEGTIKWVL 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap