Conserved Protein Domain Family
PLN02542

?
PLN02542: PLN02542 
fructose-1,6-bisphosphatase
Statistics
?
PSSM-Id: 215298
Aligned: 8 rows
Threshold Bit Score: 752.862
Threshold Setting Gi: 168006682
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168040391   4 TQAVHQVLCSSAAVATTSSEVQSCKGGLTANSLSLLPGS-SFHGSCAGLRAqnsravtdprqaaGARAAISVEPTSLPTA 82 
168006682   1 MATTQAILSATLAIAPASSCETSSRSPASTKTCLSVAGS-SLHGSVAGLGAgkqivs-vqrksvAVRAAVAAETAAPKQQ 78 
115452127   6 TTSSHLLLLSRQQAAASLQCGL---------SFRRQPGRlAGGSSAPSVRC-------------MAAVDTASAPAATEAS 63 
15232408    8 TTSSHLLLSSSRHVASSSQPSILSPRSLFSNNGKRAPTGvRNHQYASGVRC--------------MAVAADAAETKTAAR 73 
225440564  10 TASSQLHFSSSHSISRLSPFHLRVYDSRTLVSFPTNS---KRGHGVSGVRC-----------------MAVGTASEAETK 69 
224138966  10 TSSSHLLFSTSRSLSRPSPSQLCVFDSKTLVSYPNSTSTyKKKRGGDGLKC------------------MAVSTASDAKT 71 
255573935   7 LPSSRLLFSTTRSLSPLSPSQLCAFDTSTLVSFPNSNSS-KKKHVAAGVKC------------------MAVSTESEAVT 67 
297816710   8 TTSSHLLLSSSRHVAAASQPSILFPRSLFSNNGKRATSG-RNHHVGGGVRCm-----------aVAADAAAAAETKPAAR 75 
168040391  83 KKGQYEITTFTTWLLKQEQAGVIDGELTIVLSSISLACKQIASLVQRAGISNLTGLQGVANIQGEDQKKLDVISNEVFSS 162
168006682  79 AKSQYDITTLTTWLLKKEQAGVIDGELTIVLSSIALACKQIASLVQRAGISNMTGLQGAANIQGEDQKKLDVISNEVFSS 158
115452127  64 KKSSYEITTLTTWLLKQEQAGTIDGEMTIVLASISTACKQIASLVQRAPISNLTGVQGAVNVQGEDQKKLDVVSNEVFSN 143
15232408   74 KKSGYELQTLTGWLLRQEMKGEIDAELTIVMSSISLACKQIASLVQRAGISNLTGVQGAVNIQGEDQKKLDVISNEVFSN 153
225440564  70 KKSGFEIQALTSWLLKQEQAGVIDAELTIVISSISMACKQIASLVQRASISNLTGVQGAVNVQGEDQKKLDVVSNEVFSN 149
224138966  72 KKSTFEIQTLTGWLLKQEQAGVIDAELTIVISSISMACKQIASLVQRASISNLTGVQGSVNVQGEDQKKLDVVSNEVFSS 151
255573935  68 KRNTYEIQTLTNWLLKQEQAGVIDAELTIVLSSISMACKQIASLVQRASISNLTGVQGAVNIQGEDQKKLDVVSNEVFSN 147
297816710  76 KKSGYELQTLTSWLLRQEMKGEIDAELTIVMSSISMACKQIASLVQRAGISNLTGVQGAVNVQGEDQKKLDVISNEVFSN 155
168040391 163 CLRSSGRTGIIASEEEDTPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYKPNEECLTDLGEN-PTIDEVAQNC 241
168006682 159 CLRSSGRTGIIASEEEDTPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIWGIYKPNEECLTNLGEE-PTIDEIAENC 237
115452127 144 CLKSSGRTGVIASEEEDVPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECLADIADD-QNLDQVEQRC 222
15232408  154 CLRSSGRTGIIASEEEDVPVAVEESYSGNYVVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECIVDDSDDiSALGSEEQRC 233
225440564 150 CLRSSGRTGIIASEEEDVPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECLADIGDD-STLDSTEQRC 228
224138966 152 CLRSSGRTGIIASEEEDVPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECLADIGDD-STLDQTEQRC 230
255573935 148 CLRSSGRTGIIASEEEDVPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECLADIGDD-NTLDNAEQRC 226
297816710 156 CLRSSGRTGIIASEEEDVPVAVEESYSGNYVVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECIVDDSDDiSALGSEEQRC 235
168040391 242 VVNVCQPGSNLLSAGYCMYSSSVILVLSVGHGVYGFTLDPLYGEFVLSHEEIKIPKSGKIYSFNEGNYALWDDKLKKYVD 321
168006682 238 VVNVCQPGSNLLSAGYCMYSSSVILVLSVGDGVYGFTLDPLYGEFVLSHDNIQIPKSGKIYSMNEGNYALWDDNLKKYVD 317
115452127 223 IVSVCQPGSNLLAAGYCMYSSSVIFVLTIGTGVYVFTLDPMYGEFVLTQEKVQIPKAGKIYAFNEGNYALWDDKLKSYMD 302
15232408  234 IVNVCQPGNNLLAAGYCMYSSSVIFVLTLGKGVFSFTLDPMYGEFVLTQENIEIPKAGRIYSFNEGNYQMWDDKLKKYID 313
225440564 229 VVNVCQPGSNLLAAGYCMYSSSIIFVVSIGTGVFAFTLDPMYGEFVLTQENIQIPKSGKIYSFNEGNYQLWDDKLKKYID 308
224138966 231 IVNVCQPGNNLLVAGYCMYSSSVIFVLTIGKGVFSFSLDPMYGEFVLTQENIQIPKAGKIYSFNEGNYQLWDDKLKKYID 310
255573935 227 IVNVCQPGSNLLAAGYCMYSSSVIFVLTIGTGVFAFTLDPMYGEFVLTQEKIQIPKAGKIYAFNEGNYQLWDNKLKKYID 306
297816710 236 IVNVCQPGNNLLAAGYCMYSSSVIFVLTLGKGVFSFTLDPMYGEFVLTQENIEIPKAGKIYSFNEGNYQMWDGKLKKYID 315
168040391 322 SLKDPGPSGKPYSARYIGSLVGDFHRTMLYGGIYGYPRDSKSKNGKLRLLYECAPMSYLAEQAGGKGSDGHQRILDIQPE 401
168006682 318 SLKDPGTSGKPYSARYIGSLVGDFHRTMLYGGIYGYPRDSKSKNGKLRLLYECAPMSYLAEQAGGKGSDGHQRILDIQPE 397
115452127 303 SLKEPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHQRILDIMPT 382
15232408  314 DLKDPGPTGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHSRVLDIQPT 393
225440564 309 DLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDKKSKNGKLRLLYECAPMSYLVEQAGGKGSDGHQRILDIQPV 388
224138966 311 DLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDKKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHQRVLDITPT 390
255573935 307 DLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDKKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHQRILDIQPV 386
297816710 316 DLKDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHQRVLDIQPT 395
168040391 402 QVHQRVPLYVGSTEEVEKLEKFLA 425
168006682 398 QVHQRVPLYVGSVEEVEKLESFLS 421
115452127 383 EIHQRVPLYIGSVEEVEKVEKFLA 406
15232408  394 EIHQRVPLYIGSTEEVEKLEKYLA 417
225440564 389 EIHQRVPLYIGSVEEVEKLEKYLA 412
224138966 391 EIHQRVPLYIGSVEEVEKLEKYLA 414
255573935 387 EIHQRVPLYIGSLEEVDKLEKYLA 410
297816710 396 EIHQRVPLYIGSTEEVEKLEKYLA 419
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap