Conserved Protein Domain Family
PLN02880

?
PLN02880: PLN02880 
tyrosine decarboxylase
Statistics
?
PSSM-Id: 215475
View PSSM: PLN02880
Aligned: 7 rows
Threshold Bit Score: 989.794
Threshold Setting Gi: 297832624
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115471821   8 GGGEEWLRPMDAEQLRECGHRMVDFVADYYKSIEAFPVLSQVQPGYLKEVLPDSAPRQPDTLDSLFDDIQQKIIPGVTHW 87 
30680963    3 NGSGKVLKPMDSEQLREYGHLMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDVRAKILPGVTHW 82 
225437957  49 VTKESGLRPMDAEQLRENGHKMVDFIADYYKSIENFPVLSQVEPGYLRELLPDSAPNQPESLQQVFDDLQAKILPGVTHW 128
242043814   1 ---------MDAEQLRECGHRMVDFVADYYKSIETFPVLSQVQPGYLKELLPDTAPNKPDTLEALFDDIREKIVPGVTHW 71 
224065523   1 ---------MDSEQLRENAHKMVDFIADYYKSIENFPVLSQVEPGYLRELLPDSAPNQPETLQNVLDDVQAKILPGVTHW 71 
255571164   1 MFREGELRPMDAEQLREHGHKMVDFIADYYKTIENFPVLSQVEPGYLRKLLPDSAPNQPESLQNVLDDVQAKILPGVTHW 80 
297832624   1 ---------MDSEQLREYGHRMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDVRAKILPGVTHW 71 
115471821  88 QSPNYFAYYPSNSSTAGFLGEMLSAAFNIVGFSWITSPAATELEVIVLDWFAKMLQLPSQFLSTALGGGVIQGTASEAVL 167
30680963   83 QSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLPEQFMSKGNGGGVIQGSASEAVL 162
225437957 129 QSPNFFAYYPSNSSTAGFLGEMLSAGLNIVGFSWITSPAATELEMIVLDWLAKLLNLPDDFLSAGNGGGVIQGTASEAVL 208
242043814  72 QSPNYFAYYPSNSSTAGFLGEMLSAAFNIVGFSWITSPAATELEVIVLDWFAKMLRLPSQFLSTALGGGVIQGTASEAVL 151
224065523  72 QSPSYFAYYPSNSSVAGFLGEMLSAGINMVGFSWITSPAATELEMIVLDWLGKLLKLPEDFLSTGQGGGVIQGTASEAVL 151
255571164  81 QSPNYFAYYPSNSSVAGFLGEMLSAGINMVGFSWITSPAATELEMIVLDWLGKMLKLPEEFLSTGQGGGVIQGTASEAVL 160
297832624  72 QSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWLAKLLNLPEQFMSKGNGGGVIQGSASEAVL 151
115471821 168 VALLAARDRALKKHGKHSLEKLVVYASDQTHSALQKACQIAGIFSENVRVVIADCNKNYAVAPEAVSEALSIDLSSGLIP 247
30680963  163 VVLIAARDKVLRSVGKNALEKLVVYSSDQTHSALQKACQIAGIHPENCRVLTTDSSTNYALRPESLQEAVSRDLEAGLIP 242
225437957 209 VVLLAARDRVLRTVGKTALEKLVVYGSDQTHSALQKACQIGGIHPENCKLLKADSSTGYALSPDLLSEAVSHDITNGLIP 288
242043814 152 VVLLAARDRTLRKHGKTSLEKLVVYASDQTHSALQKACQIAGIFPENVRLVKADCNRNYAVAPLAISDAIATDLSSGLIP 231
224065523 152 VVLLAARDRVLRKLGKNALEKLVVYASDQTHSALQKACQIGGIHPENCKLLKTGSPTNYALSPDLLGKAISDDISTGLVP 231
255571164 161 VALVAARDKVLRRVGKDALRKLVVYGSDQTHSALQKACQIGGIHPVNCRLLETDSSTNYALAPDLLSRAISEDISLGLIP 240
297832624 152 VVLIAARDKVLRSVGKNALQKLVVYSSDQTHSALQKACQIAGIHPENCRVLKTDSSTNYALRPELLQEAVSQDLDAGLIP 231
115471821 248 FFICATVGTTSSSAVDPLPELGQIAKSNDMWFHIDAAYAGSACICPEYRHHLNGVEEADSFNMNAHKWFLTNFDCSLLWV 327
30680963  243 FFLCANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWV 322
225437957 289 FFLCANVGTTSSTAVDPLLELGKVTKSNGIWFHVDAAYAGSACVCPEYRHYIDGVEEADSFNMNAHKWFLTNFDCSVLWV 368
242043814 232 FFICATVGTTSSSAVDPLPELGQIAKANDMWLHIDAAYAGSACICPEYRHHLNGVEEADSFNMNAHKWFLTNFDCSLLWV 311
224065523 232 FFLCATVGTTSSTAVDPLLSLGKIAKNNGIWFHVDAAYAGSACICPEYRCYIDGVEEADSFNMNAHKWFLTNFDCSALWV 311
255571164 241 FFLCATVGTTSSTAVDPLLALGKIAKSNGMWFHVDAAYAGSACVCPEYRCYMDGVEEADSFNMNAHKWFLTNFDCSALWV 320
297832624 232 FFLCANVGTTSSTAVDPLAALGKIANRNEMWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWV 311
115471821 328 KDRSFLIQSLSTNPEFLKNKASQANSVVDFKDWQIPLGRRFRSLKLWMVLRLYGVDNLQSYIRKHIHLAEHFEQLLLSDS 407
30680963  323 KDQDSLTLALSTNPEFLKNKASQANLVVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDP 402
225437957 369 KDRNALVQALSTNPVFLKNKASDANMVVDYKDWQVPLGRRFRSLKLWMVLRLYGVENLQRYIRNHIKLAKQFEELVAQDP 448
242043814 312 KDRSYLIQSLSTNPEFLKNKASEANSVFDFKDWQIPLGRRFRSLKLWMVLRLYGVENLQSYIRKHIELAKEFEQLVISDS 391
224065523 312 KDRNALIQSLSTNPEFLKNKASQANMVVDYKDWQIPLGRRFRSLKLWMVLRLYGLENLQCYIRNHINLAKYFEGLVAADS 391
255571164 321 KDRNALIQSLSTSPEFLQNKPSQTNTVVDYKDWQIPLGRRFRSLKLWMVLRLYGVEKLQCYIRNHINLAKYFEGLIAEDT 400
297832624 312 KDQDSLTLALSTNPEFLKNKASQANLVVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDP 391
115471821 408 RFEVVTPRTFSLVCFRLVPPTSDHENGRKLNYDMMDGVNSSGKIFLSHTVLSGKFVLRFAVGAPLTEERHVDAAWKLLRD 487
30680963  403 NFEIVTPRIFALVCFRLVPVKDEEKKCNNRNRELLDAVNSSGKLFMSHTALSGKIVLRCAIGAPLTEEKHVKEAWKIIQE 482
225437957 449 RFEIVAPRKFALVCFRLLPPHRNEDFSNKLNHNLLDTVNSTGKVYISHTALSGKYTLRLAVGAPLTEERHVNAAWKVIQE 528
242043814 392 RFEVVTPRTFSLVCFRLVPLASDQDNGRKLNYDLMDAANSSGKIFISHTVLSGKFVLRFAVGAPLTEGQHIFSAWKILQD 471
224065523 392 RFEVVTPRIFSLVCFRLLPPNNNEDHGNNLNHDLLDAVNSTGKIFISHTVLSGKYILRFAVGAPLTEERHVTAAWKVLQD 471
255571164 401 RFEVVSPPIFALVCFRLLPPDNNVDHGNKLSHDLLDAVNSTGKIFISHTVLSGKYILRFAVGAPLTEERHVTAAWKVLQD 480
297832624 392 NFEIVTPRIFSLVCFRLVPVKNEEKKCNNRNRELLDAVNSSGKLFISHTALSGKIVLRCAIGAPLTEEKHVKEAWKVIQE 471
115471821 488 EATKVLGK 495
30680963  483 EASYLLHK 490
225437957 529 KASVLLSE 536
242043814 472 LATKQLLE 479
224065523 472 EASALLGS 479
255571164 481 EACALLET 488
297832624 472 EASYLLHK 479
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap