Conserved Protein Domain Family
PLN02949

?
PLN02949: PLN02949 
transferase, transferring glycosyl groups
Statistics
?
PSSM-Id: 215511
View PSSM: PLN02949
Aligned: 12 rows
Threshold Bit Score: 647.18
Threshold Setting Gi: 303275778
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255088095  25 LTCVLFVVVIVH-QWLRSGPEVPNSVGFFHPFTSDGGGGERVLWCAVREIQR--ARPDCQCVIYTGD-DA-------SGE 93 
145350584   1 MFKTSAKQRRRV-RGVVRGAGRGRVIGFYHPSGGDGGGGERVLFAAIAAAQRatEGRDVTCCVYAGAtSArgdepveDGD 79 
168056013  13 GAALLCAVVFLK-TVLRARRSVKPVVAFFHPYTNDGGGGERVLWCAARAVQE--MAPALDIVVYTGD-SA-------TPE 81 
42569790   12 TIIFAVSLSLFL-SVINARKSRKRAVGFFHPYTNDGGGGERVLWCAVKAIQE--ENPDLDCVIFTGDhDS-------SSD 81 
225448485  12 SGAVALILSYISlSIVKGRSNRRHGVAFFHPYTNDGGGGERVLWCAVKAIQE--ESSDLDCVIYTGDhDA-------SPD 82 
224119626  14 TSLLTFILTITSrEIINGRRTRQRAVGFFHPYTNDGGGGERVLWCAVKAIQE--ESPDLDCVIYTGDhDS-------SSE 84 
242086032   9 AVLSALLAAVLR-RLLIPRRRPADAAGFFHPYTNDGGGGERVLWCAVRAVQE--LRPDLPCAVYTGDaDA-------APD 78 
255574810  14 TAIFTLLSTFAS-QIINGRLNRKQAVGFFHPFTNDGGGGERVLWCAVKAIQE--ESPHLDCVIYTGDhDA-------SPQ 83 
303275778  24 VSVVLLVVASAL-SYLRAGRRTPNSVGFYHPHTSDGGGGERVLWCAVREVMR--ANPSATCVVYSGD-GV-------AAS 92 
302759607   3 VVGALLLVAAAV-LFLARRWECKRAIAFFHPYTNDGGGGERVLWCAVRAVQE--MFPDVPCAIYTGD-EA-------TPS 71 
297823943  12 TIIFAVSLSLSL-SVINARKSRKRAVGFFHPYTNDGGGGERVLWCAVKAIQE--ENPDLDCVIFTGDhDS-------SSD 81 
297789912  12 TIIFAVSLSLSL-SVINARKSRKRAVGFFHPYTNDGGGGERVLWCAVKAIQE--ENPDLDCVIFTGDhDS-------SSD 81 
255088095  94 ELARRAKERFGVELRTVPGVVKLRWRDLVVPERYPVL------TMVGQAIGGALLTAEAVTSYRPTVFFDTVGHAFGYPV 167
145350584  80 ELIARARERFGIELRAPINVIRLTRERWARAETYKRC------TILGQFIGGAWLGLEALWTFAPDVFVDTVGHAATYPI 153
168056013  82 SLAARALDRFGVRLVKAPLVVKLDKRKWVESKTYPRF------TIIGQSLGSMVLAWEALSKVTPLIFLDTSGYAFTYVF 155
42569790   82 SLARRAVDRFGVHLQSPPKVIHLNKRKWIEESTYPHF------TMIGQSLGSVYLAWEALRMFTPLYFLDTSGYAFTYPL 155
225448485  83 SLMARAVQRFGVELLYPPKVVHLYKRKWIEETMYPRF------TMIGQSLGSVYLSWEALCKYTPLYYIDTSGYAFAYPV 156
224119626  85 SLMSRALDRFGVQLLTPPKVVHLYKRKWIEETSYPRF------TMIGQSFGSVYLSWEALCKFTPLYYFDTSGYAFTYPV 158
242086032  79 ALAARALDRFGVRLLRPPQVVHLNKRKWIEASTYPHF------TMIGQSLGSVYLAWEALTNFTPMFYFDTSGYAFTYPL 152
255574810  84 SLASRATDRFGVNLLYPPMVVHLYKRKWVEETSYPRF------TVIGQSFGSIYLAWEALCKFPPLYYFDTCGYAFTYPL 157
303275778  93 VLATRARERFGVILPRAFDVVALRRRALADPGLYPCSrwrpspRQRDPRRGGD-------DAFRPAVFFDTVGHAFGYPV 165
302759607  72 SLAARAWEKFGVKLHSPPQVVRLRTRNLIDPSNYPHF------TLLCQSLGSIVLGLEALVRLRPVLFFDTSGYALTYPL 145
297823943  82 SLARRAVDRFGVHLQSPPKVIHLSKRKWIEERTYPHF------TMIGQSLGSVYLAWEALRKFTPLYFLDTSGYAFTYPL 155
297789912  82 SLARRAVDRFGVHLQSPPKVIYLSKRKWIEERTYPHF------TMIGQSLGSVYLAWEALRKFTPLYFLDTSGYAFTYPL 155
255088095 168 AR-LAGCVVACYVHYPTISSDMIARVATRSDMYNNRSIVAR---FWLLSALKLAYYRLFAVAYGWCGRYATCVAANSSWT 243
145350584 154 ARyLFGCQTVAYVHYPTVSRDMIARVESGRLMYNNSRLFAS---SKFLSGLKVLYYRAFAVVYGWCGRSCKCVMVNSSWT 230
168056013 156 AR-AAGSLVVCYTHYPTISTDMLNRVRDRTALYNNDIRISR---SFLLSMAKVWYYRALAQLYGLAGRCAHLAMVNSSWT 231
42569790  156 AR-IFGCKVVCYTHYPTISLDMISRVRQRNSMYNNDASIAK---SNWLSTCKLVYYRAFSWMYGMVGSCTHLAMVNSSWT 231
225448485 157 AR-LFGCKVICYTHYPTISLDMISRVQDQNSMYNNDALIAK---STWLSLCKVIYYRLFGWMYGTVGSFAHLAMVNSSWT 232
224119626 159 AR-LFGCKVICYTHYPTISLDMISRVRDRSSMYNNDASIAR---SGWLSWCKIIYYTLFSWMYGFVGSCAHLAMVNSSWT 234
242086032 153 AR-LFGCKVICYTHYPTISSDMVERVKHRSSMYNNNSRIAG---SIWLSRCKILYYTIFSWLYGLVGSCAHLVMVNSSWT 228
255574810 158 AR-IFGCKVICYTHYPTISLDMISRVRDRSSMYNNNASIAR---SGWLSRCKIIYYTFFSWMYGFVGSCAHLAIVNSSWT 233
303275778 166 AR-VAGCRVAAYVHYPTVSSDMIKRVKARRVVYNNAESTAK---SSARTWAKTLYYRALARVYGACGRCAAVVMCNSSWT 241
302759607 146 AR-LFGCKVACYTHYPTISSDMVSRVSNRSSLYNNSGVIARrqvSFLLSTGKIVYYELMALMYGLAGRCANLAMVNSSWT 224
297823943 156 AR-IFGCKVVCYTHYPTISLDMISRVRQRNSMYNNDASIAK---SNWLSTCKLVYYRAFSWMYGMVGSCTHLAMVNSSWT 231
297789912 156 AR-IFGCKVVCYTHYPTISLDMISRVRQRNSMYNNDASIAK---SNWLSTCKLVYYRAFSWMYGMVGSCTHLAMVNSSWT 231
255088095 244 AAHLRRLW--------RV-DRIrvVYPPCDVAGL-TDFSLSDrsgwgrstgvqggeggvqgveggvqgverveanerveg 313
145350584 231 KSHIDALW--------RVdSRV--VYPPCNVEDL-SKLPLTRprlnar-------------------------------- 267
168056013 232 RAHINAIW--------RIpNRTvlVYPPCDTLTLqQALPLER-------------------------------------- 265
42569790  232 KSHIEVLW--------RIpERItrVYPPCDTSGL-QAFPLER-------------------------------------- 264
225448485 233 QSHIESLW--------RIpERTkrVYPPCDTSGL-QALPLER-------------------------------------- 265
224119626 235 QSHIEKLW--------RIpSRIkrVYPPCDTSGL-QVLPLER-------------------------------------- 267
242086032 229 RSHILNIW--------KIpEHTkrVYPPCDTSSL-QVLPLER-------------------------------------- 261
255574810 234 QSHIEKLW--------KIpNRIkrVYPPCDTSGL-QALPLER-------------------------------------- 266
303275778 242 EAHVRALWggtasasaTAtATPrvVYPPVDVSAL-EKLPIEGrgvsrrragadggaeggaeg-----gaeggtegnaeie 315
302759607 225 LSHIEKLW--------Kg-ARIvrVYPPCNTESL-QELPLER-------------------------------------- 256
297823943 232 KSHIEVLW--------RIpERItrVYPPCDTSGL-QAFPLER-------------------------------------- 264
297789912 232 KSHIEVLW--------RIpERItrVYPPCDTSGL-QAFPLER-------------------------------------- 264
255088095 314 veggggNGDGPYLVSVGQFRPEKDHALQLRAWAKMRAder---daTTPSVPPNARLKIVGGCRNEGDERRLDALRSLTKD 390
145350584 268 gtpvkkDKSSIRVVSVGQFRPEKAHVVQIAAWKALKKf------kTLSSKIENAILVFVGGCRDEADRERLADLQQSVKD 341
168056013 266 ------LPQKQYIISVAQFRPEKAHDLQLEAFALALE--------QLSLQNMEARLKLVGSCRNQEDENRVDSLKQRCQD 331
42569790  265 ------SSDPPKIISVAQFRPEKAHMLQLEAFSLALE--------KLDADVPRPKLQFVGSCRNNSDEERLQKLKDRAVE 330
225448485 266 ------LRSSPAIISVAQFRPEKAHTLQLMAFSVAIR--------NLDADLPRPKLQFVGSCRNKSDEERLQNLKDKAIQ 331
224119626 268 ------PTTTPIFISVAQFRPEKAHPLQLEAFSLAIR--------RLDADMPRPILQFVGSCRNKFDEDRLQKLQDKAVE 333
242086032 262 ------PTTPPIFISVAQFRPEKAHGLQLEAFALALQ--------RLDPDFPKPKLQFVGSCRNKEDLDRLQKLKDRSTE 327
255574810 267 ------SVDPPRFVSVAQFRPEKAHSLQLEAFAVAIG--------KLDADSPRPKLQFVGSCRNNFDEERLQKLQDKAIE 332
303275778 316 eakeeeEEDGKYVVSVGQFRPEKDHALQLRAWARVKArenearrdAGETDGPEWKLKIVGGCRGKDDERRVATLRALAAE 395
302759607 257 ------SERELYFISVAQFRPEKNHDLQVEAFAMALE--------KLSAE-KRPRLKLVGSCRNEEDAKRLSDLKSLCAK 321
297823943 265 ------SSDPPKIISVAQFRPEK----------------------KLDADVPRPKLQFVGSCRNNSDEERLQKLKDRAVE 316
297789912 265 ------SSDPPKIISVAQFRPEKAHMLQLEIFALALE--------KLDADVPRPKLQFVGSCRNNSDEERLQKLKDRAVE 330
255088095 391 LGVDDSVEFHVDVPYARLRELLGGAAGGVHTMLDEHFGICVVEYMAAGAVPIAHDSAGPAMDIVVpavrpeasegddesp 470
145350584 342 LELQDSVQFHVDVSYDEVKRELSRASIGLHSMIDEHFGICVVEYMAAGAVPVAHASGGPFLDIIR--------------- 406
168056013 332 LGLEQNVDFCLNVHYSELVKLLGGAIAGLHTMTDEHFGIVVVEYMAAGAVPIAHNSAGPKLDIVV--------------- 396
42569790  331 LKVDGDVQFYKNAMYRELVELLGNAVAGLHGMIDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVL--------------- 395
225448485 332 LKLEGDVEFHKNVMYRDLVGLLGGAVAGIHGMIDEHFGISVVEYMAAGAIPIANNSAGPKMDIVL--------------- 396
224119626 334 LNVDGDVQFYKNVMYRDLVRLLGGAVAGMHSMVDEHFGISVVEYMAAGAVPIAHNSAGPKMDIVL--------------- 398
242086032 328 LQIDELVEFHRDISYSDLVRLLGGAISGLHSMTDEHFGISVVEYMAAGAIPIAHKSAGPMMDIVL--------------- 392
255574810 333 LKVNGDVEFYKNVLYRDLVSLLGGAIVGMHSMIDEHFGICVVEYMAAGAIPIAHNSAGPKMDIVL--------------- 397
303275778 396 LGLKTSVEFHVDVSYEDVVRHLRGAVAGLHAMLDEHFGICVVEYQAAGAVAIAHDSAGPKMDIVV--------------- 460
302759607 322 LGIQDHVDFHENISYTALRDLLGGAIAGIHFMIDEHFGISVVEYMAAGAIPIAHNSAGPRMDIVV--------------- 386
297823943 317 LKVDGDVEFYKNAMYRELVELLGNAVAGMHGMIDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVL--------------- 381
297789912 331 LKVDGDVEFYKNAMYRELVELLGNAVAGMHGMIDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVL--------------- 395
255088095 471 ndgpsgDDVArLP-VGFLATTVDGYADAMWAALSMTDDERVTMATLARARANAFGEGKFNGAFldaVAPALASLAV 545
145350584 407 ------DQHD-GP-TGFTADSVATFAETLEHLLLMRRTEREEISARARARSDIFSETEFNSNF---IDSLVNSGVL 471
168056013 397 ------NEGG-HR-TGFLASSVSEFADAMCHVVTLPANERMEIAQAARVRAALFSESEFDSAFkkaMNPLIEQAFR 464
42569790  396 ------EEDG-QK-TGFLAETVEEYAEAILEIVKMNETERLKMAESARKRAARFSEQRFCEDFktaIRPIFTGPLK 463
225448485 397 ------EEDG-QQ-TGFLAQTVEEYADAILKILRMPETKRLEMAAAARRRAGRFSEQRFYEDFkaaVRPILSHAS- 463
224119626 399 ------EEDG-QQ-TGFLAQNVDEYAEAILKVLRMPETERLKIAAAARKRAGRFSEQRFYEDLkaaIQPILNHVSR 466
242086032 393 ------DEDG-HQ-TGFLASEKEEYTEAIIKVLRMRESERQEMAAVARKRAQRFSDQRFHEDFteaVRHILSAREA 460
255574810 398 ------EEDG-EQ-TGFLCQNVEEYADAILSVLRMPDTETLKMAAAGRKRANRFSEQRFYEDFkaaIRPIVNQASR 465
303275778 461 ------PSAPrEDaVGFLATTETEFADAIVEVMTMRADAREAIAARARARSSKFSEAAFASGLrda---------- 520
302759607 387 ------DEDGdQK-TGFLAATVPELASKMVEVLSMASSERLEIAKAARRRCHRFSERQFNDSFkqaMTMFHL---- 451
297823943 382 ------EEDG-QR-TGFLAETVEEYAEAILEIVKMSEKERIKMAESARKRAVRFSEQRFCEDFktaIQPIFTGPLK 449
297789912 396 ------EEDG-QR-TGFLAETVEEYAEAILEIVKMSEKERIKMAESARKRAVRFSEQRFCEDFktaIQPIFTGPLK 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap