Conserved Protein Domain Family
egt

?
PHA03392: egt 
ecdysteroid UDP-glucosyltransferase; Provisional
Statistics
?
PSSM-Id: 223071
View PSSM: PHA03392
Aligned: 45 rows
Threshold Bit Score: 578.064
Threshold Setting Gi: 32698657
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209170916   4 RVVPILLLALFLLGRAAPARILAVFPTPAYSHHSVFKVYIRALVERGHEVVVIKSTNRISYTDelplysnedddrdLRRN 83 
288804758   1 --MFFVVLLSCCLSIVQGSNILCVFPTPAFSHQTVFAAYVDKLATAGHNVTVITPMPRN------------------VKH 60 
11068121    1 ---MTLKLLILFLGAANSANILCVFPTPSYSHHTVFKKYVATLSESGHNVTVITPFEYNDCHNcl--------------- 62 
14602378   17 FRNNLVLLLPSLVHFVHTANILCVFPTPAFSHQSVFSAYTDRLAKAGHNVTVITPLPRR------------------VPH 78 
21686794   10 FKMIKLIFFLFFVVKTESANILCVFPTPAYSHQSVFNVYMDKLVDYGHNVTVITPVPR---------------------R 68 
32698657    1 --MYSLIVLSLLFTVVSSARILCVFPIPSYSHHLVYSAYTDSLVKNGHNVTVITPMPRH------------------VKH 60 
33622328    1 -MYSIFVVLLCCAAYNDAANILCVFPTPAYSHQSVFSAYVDKLIEAGHNVTVITPMPRRISNE----------------- 62 
86355658    1 -MGFIVIILTWLTVGARAANILAVLPTPAYSHHVVYRAYVHALIKQCHNVTVIKPQLLNYTLQd------------ECGS 67 
96979890    1 ---MSFIALLLLAATARAADVLAVLPTPAYSHHLVYRAYVRALADECHSVTVIKPRLLDYAAEd------------sCGR 65 
109255387   1 -MFVQLILVVLAPCFVCSSNILCVFPTPALSHQSVFAAYVDKLVIAGHNVTVITPMPRG------------------VQH 61 
209170916  84 ITEIDAs-lSQDYFKRLMKQAGVFRKRGLVADSGTVTAHNYVSLVRMISDQFDLPDVKSFLDKrQHLKFDVLITEAFIDY 162
288804758  61 ITEIGCk-lSVQYFTSLVKNSTMIKQRGVVADENTVTADNYIPLVDMVVEQFKSENVTKLLTN-KDNHFDLVVCEAFLSI 138
11068121   63 --------vPSYMFQKLTTSV-------VVADETTVTKTNYMSLINLITQQMKSENVTSLLNN-KDTKFDLVVAEAYLEM 126
14602378   79 LHEIDCs-kSLTVFNELVKKSSLFKVRGVVADESTVTADNYTPLVDMVVAQFQNKNVTDLIEN-KANMFDLVVCEAYLSL 156
21686794   69 VSHLKEiivPNNTFEQLVNNSA------MVVKEDSVTAEKYTPLIDMVAEQFASENVSKLVS--SDTKFDLVVCEAYLTL 140
32698657   61 LTEIDTsknTLNVYSALMSTAKA---------DQIFVAEQYRDLLNMVVDQFNSDGVVALLNN-TNVKFDLIVCESMLNI 130
33622328   63 ---IDCs-kSLAVFGALVKNSTDFRIRGIVADETTVTVEKYTPLVEMVASQFQNANVTKLYQN-KDNKFDLVVCEAYLSM 137
86355658   68 VEQIDAd-mSSQQYKKLITSSNIFRKRGVVADETTVTADNYMGLINMFKDQFDNANVRRFLA--ENRTFDAVAVEAFADY 144
96979890   66 VKQIDAd-lSAHHLA----------------------------------------------------------------- 79 
109255387  62 VTEIDCs--TKNVFVNLVKNSTSLKKRGLVADELTVTAENYTPIIDMVVEQIKSYNVTNLLKN-KDNNFDLVVCEAYLDI 138
209170916 163 ALVFSHLFGDIPVIQISSGYAVAENFETMG--AVSRHPVYYPNLWRDKFsglNVWDMINEIYVELRLQNEFSKLADEQNR 240
288804758 139 NLIFGYLY-RAPVIRISSGYGTNENFETMNt-GVVYNFTKHPNMWRSKF---YVHNEHKAKMLEQKLAGEWAVLEQTQEQ 213
11068121  127 LLMFSHFY-QAPVIQMSSGHALPENFETMG--AVSRNAVKHPNLWRSSH----------NIDYENKLQREWKLIEHAQDN 193
14602378  157 NLIFGHLF-DAPVIRISSGHGTTENFDTMG---AVHNPLVYPSSWRSTF----STNKTQIMEIEHRLAHEWKKLERVQET 228
21686794  141 PLVFGHVF-QAPTIRFSSGYGTNENFYTMNknGVDFNSVMYPNMWRSGN-----FGSTNDFYIENRLDEEWTALERVQDE 214
32698657  131 NLYFGHVY-KSPIIWISSGRATNDNYNTLLnkTASYNNQIYPNVFNTLN---CENEEKCHDDEELRINEEWNKFDVIQHD 206
33622328  138 NLIFGHLF-NAPVILMSSGHGTKENFKIMNr-GVTYNSFVHPNSWRSTF----TSNKTQIETIENRLEEEWNQLEHIQDM 211
86355658  145 ALVFGHIFSPAPVIQIAPGYGLAENFDTAG--AVARHPVHFPNIWRSNF---NDGKEAASALSEWRLFNEFELLARRADE 219
96979890      --------------------------------------------------------------------------------    
109255387 139 ILIFGHLY-RTPIIKFSSGYGTNENFKTMNa-DVKYNSVVYPNLWRSNF---------SNENIEQALNTEWQKLKQIQNI 207
209170916 241 LLKRQFGADT-PTVQELRNRVQLLFVNTHAVFDNNRPVPPSVQYL-GAMHL--VDKRPKPLFGMVRELLDNATEGAVYVS 316
288804758 214 RLKQLFGDNI-PSMSQLKEKVLMLFINVASVYDNNRAVGDNVQYL-GGLHL----KKPQPITDIELSMFLNNIDVVIYVS 287
11068121  194 VARKQFNSRP---LKILRENVKLLLVNVPTIMDNYRSVPQTVQYL-GGLHL--NSTTIEPLDDELKRFADRGK--FIYVS 265
14602378  229 RLKQVFGGGSgTSLHSLKKRVVLLLVNVHPVMDNNRPVSSNVQYL-GGLHL---KRAQSIKDEELRAFIKNDF--VVYVS 302
21686794  215 KAKKLFGNYV-PPLKVLAERNALLFVNVPAVLDNNRPVGDNVQYL-GGLHL-------SKRSNPLRNYELGRHKNVVYVS 285
32698657  207 LLTKHFGQDI-PAIDELKKRVKLLFINTASHFDNDRPINSKVQYL-GGLHLttPPPILSDVDVKLTNFLAAPNTTIIYVS 284
33622328  212 RLKQMFGNGT-PAIRELKKRVVLLFINVYPVIDNNRAVSNNVQYL-GGLHL---KRPLPLKDDHQLRLFIRGKTPVIYVN 286
86355658  220 LLKQQFGRDT-PSIRQLRNNVQLLLLNLHPVYDNNRPVPPSVQYLgGGLHLt-KTAQLQRLEIALERRLNKSVDGAIYVS 297
96979890      --------------------------------------------------------------------------------    
109255387 208 RLQKLFGDRT-STISVMQQSVKLLFVNVPHVFDSDRPVGENVQYL-GGIHL---KKPRPVRDIKLIEFLNQKTN-IIYVS 281
209170916 317 FGSGISTDEMESEFIEMLLRTFRALP-YTILWKYDGFLT----NLPPNVFIQSWFDQYNLLHHKNVRAFVTQGGVQSTDE 391
288804758 288 FGSIMDVSAMDQNMLSELVRVFNSLP-YNVLWRAPDTIRtr-fNLSSSVLTRNWFPQRDILNHPNVKLFVTQGGVQSMDE 365
11068121  266 FGATKDLRNFD--ILSKMSRTFSNCK-YNVLWKSRSYFN-----ISENIMTRDWLPQRSVLKHENLKLFITQGGVQSIDE 337
14602378  303 FGSMLDATTMDHRALQEFVRVMNALP-YKVLWRVGSSVHqrfsVNGSNILTREWFPQRALLNSGVVKLFVTQGGLQSIDE 381
21686794  286 FGSVATV--FDNDTMTEMVRVFNSLP-YTVYWKTNDRSD-----LGKNILTRKWFPQRELLNYGNIKLFITQGGVQSTSE 357
32698657  285 FGS----NNFNNTILKNVFVALAASP-FKILLHATPEHDy---NNTNNVLVRKWLPQRNILKNPRVKLFITQGGILSIDE 356
33622328  287 FGSILEANNMDLDALGEFVRVFNKLP-YKILWRVNKSIHqr-fNISKNVLIRDWFPQRDLLFNSRIKLFVTHGGLQSMDE 364
86355658  298 FGSSINTNLIHAEFLQMLLDTFVQLNnRTVLWKVDDAAVas-iTLPRNVVIQKWFNQRSVLHHKNVVAFVTQAGIQSSDE 376
96979890      --------------------------------------------------------------------------------    
109255387 282 FGSILDAAAMDESLLTEFVKVFTK---FNVLWKIDNVVSsk-fNLSDNILTRNWFPQRDILNHPNVKLFITQGGVQSVDE 357
209170916 392 AIDALVPLVGMPMMGDQAFNTNKYIELGIGRVVDTVHVDAFQLTEAITDVAQN--PTFRKRLNELRHFIRHQAVSPIHKA 469
288804758 366 AIDSEVPTLGLAMAGDQFYNVHKTVQLGIGKSVNILKLEKERLDKKIVHMINN--DRYTKRLRDLKKYIRSTTVDPLRKA 443
11068121  338 AIDNTVPMLVVPTMGDQFFNAKRIVDLGIGKKGDL--FNTGLMGRQINKIIDNy-DLFKDNLKIVKRLINDKPMSSTHAS 414
14602378  382 AVDGGVPMLCIPMVGDQFLNCERVWRLGVGEKLDVVQLEQAKMDRMIVSMVAN--ERYNERVDDLKKLVSDTPVNALRKV 459
21686794  358 SIEAGVPMLVLPLMGDQFYNAHRLVQLGVAETVDILGLKNIQLENKIIHMMTN--TKYAEQTKKL----------NVNKL 425
32698657  357 AVDNEIPMIVVPLMGDQFLNARNIKQLNIGETLRARSISN---LNQTIDLMMQnyDNYKSNIVQYKKRINDDLSTPQHKS 433
33622328  365 AIDSGVPMMCIPLMGDQFLNCERVFQLGIGEKVNMVTIEQEKIDKLIENMINN--NKYYVRVGELKKLIRDRPLKPVHRA 442
86355658  377 ALAARVPMVCLPMMGDQFYHARKLQQFGVALSLNTATVSAAQLALAINAVIADq-ETYRERIDDLRAVLEHDNDAPAKKA 455
96979890      --------------------------------------------------------------------------------    
109255387 358 AVDSEIPLICIPMVGDQFVNCRRIDQLNIGVVVNILKLESENLYKKINDVMND--TTIVDKIHALKKNIHDAPMKPLHKA 435
209170916 470 IWYTEHVINTsn---gGGTMLKTKAANVNYSDYIMSYIF 505
288804758 444 LWHTNRVLKNsnlmylFNK-------------------- 462
11068121  415 LWYTNYVLRNkdlkr------------------------ 429
14602378  460 LWYTDKVLR-------NGSLMYVFNGNKYWSK------- 484
21686794  426 FDKIYCFIK------------------------------ 434
32698657  434 VWYTNKVIRLfk--------------------------- 445
33622328  443 LWYTEKMLRNkdvmfmFNENK------------------ 463
86355658  456 VKYTERVINFsydvnrPARLLKTTAANMAYSDYFLRFPL 494
96979890      ---------------------------------------    
109255387 436 LWYTQKVLRNnky-------------------------- 448
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap