Conserved Protein Domain Family
Fbp

?
COG0158: Fbp 
Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 223236
View PSSM: COG0158
Aligned: 23 rows
Threshold Bit Score: 335.052
Threshold Setting Gi: 11386864
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17366758   3 GATLEAYLASCTARGDDLSRDVAAVIQRLAKAALDIRKLVNQGALGTAFnGTHGGSNTDGDLQKDLDILCDDQFLTCLQG 82  Sinorhizobium meliloti
17988767  21 AETVGAYLDGWAGHDKVRLATANAIKAILSGAGRLVGR-IARGYLPGDP-GKLVGVNSDQDQQKSIDVGSHNLFVELLIA 98  Brucella melitensis
16125634  11 RMTAFVDLAARLAAEPA-DAALKDVVLTIAETCAQISRVVASGALSGSL-GAAGSTNVQDEEQKKLDVITNDMLSDALKA 88  Caulobacter crescen...
15792178   1 ---------------------MQEVISYIQKAVLEISNALKFPDTS-----YSQNQNFTGDTQLKFDVLSDEIITKTLSQ 54  Campylobacter jejuni
3913634    1 ---------MDYKCFKGkHANIVIEIISLLEKGVKKAQEILEKPDAG---SYTKLENSSGDTPIKADLALDKFLEENFLS 68  Helicobacter pylori
15794192   1 MDTLTRFLPEHLQQNQL-PEALGGVLLSVVSACTEINAKVRLGALAGVL-GMAGTGNIQGEDQKKLDVIANNIMIDTLKA 78  Neisseria meningiti...
15676944   1 MDTLTRFLPEHLQQNQL-PEALGGVLLSVVSACTEINAKVRLGALAGVL-GMAGTGNIQGEDQKKLDVIANNIMIDTLKA 78  Neisseria meningiti...
15600303   3 RVTLSRYLIEQTRSHNT-PADLRFLIEVVARACKEISHAVSKGALGGVL-GSMGTENVQGEVQKKLDVMSNEILLEANEW 80  Pseudomonas aerugin...
17546845   3 RINLTRYLIEEQREHNTIPAELRLLLEVVARACKAISHSVNKGALAGVL-GSAGTGNVQGETQQKLDVIANEVLLEANEY 81  Ralstonia solanacearum
11386864   1 ---------MDYKRFKGkHANIVIEIISLLEKGVKKAQEILEKPDAG---SYTQLENSSGDTPIKADLALDKFLEETFLS 68  Helicobacter pylori...
17366758  83 -APVACYASEELENPVLLDP---SARLAVAIDPLDGSSNIDNNVSIGTIFSVLPAAkg---pDVDPSQS-FLQPGNRQLA 154 Sinorhizobium meliloti
17988767  99 -AGVASILSEEADLPVAGKAd---GLVAVAIDPLDGSGNVGLGAPLGTIFSIFPAD----------VEEpFLQPGNRQIA 164 Brucella melitensis
16125634  89 cGPVAGLASEELEEVEPTGR---VGGYLVTFDPLDGSSNIDVNVSVGTIFSVLPAPa-----GHAPTEGdFLQPGRNQVA 160 Caulobacter crescen...
15792178  55 cSSIKAIISEEKDEILTLNEr---ANFIVAYDPLDGSSLMDVNFAIGSIFAIYEEK----------------ASAKNLRA 115 Campylobacter jejuni
3913634   69 lENIKSVFSEEKETPVTKEN----GSYLIAYDPLDGSSVMEANFLVGTIIGIYEKD----------------YKAQNLAA 128 Helicobacter pylori
15794192  79 nPAVAGLASEEEDSFVSAGE---NGRYLVLFDPLDGSSNIDVNISVGTIFSILEKPe-----GALATES-FLQTGRQQLA 149 Neisseria meningiti...
15676944  79 nSAVAGLASEEEDTFVNAGE---NGRYLVLFDPLDGSSNIDVNISVGTIFSILEKPe-----GALATES-FLQTGRQQLA 149 Neisseria meningiti...
15600303  81 aGNLAGMASEEMDHPYQIPGrypKGAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPneylnqNDTLREEaFLQPGTTQVA 160 Pseudomonas aerugin...
17546845  82 gGNLAAMASEEMESFYEIPHrypKGEYLLLFDPLDGSSNIDVNVSIGTIFSVLHMPk----pGQTVTEAdFMQPGVRQVA 157 Ralstonia solanacearum
11386864  69 lENVKSVFSEEKETPVTKEN----GSYLIAYDPLDGSSVMEANFLVGTIIGVYEKD----------------YKAQNLVA 128 Helicobacter pylori...
17366758 155 AGFFIYGPQTALVLSLGKGTEIFIFSSRLGCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDDCLAGSEGPReRD 234 Sinorhizobium meliloti
17988767 165 AGYVSYGNSVDLGFSVGEGVIFATLDPVSGQFHITRRNVKLPERTSDLAFNASVQRHLSAGMQAYVNDAFLGKDGPRgRN 244 Brucella melitensis
16125634 161 AGYAVYGPQTMLVVTLSGGVNGFTLSADG-RWLLTHPDLAIKPDTAEFAINMSNQRHWAPAVRRYIDGCLQGKDGARgKN 239 Caulobacter crescen...
15792178 116 ALYSMYGARLELVICKDQ-PKLYRLNANN-EF-IFIKDLRMNEKGKINATG-GTQKFWEEKHAKFIKSLFDEGYR----- 186 Campylobacter jejuni
3913634  129 SLYVVFGHKIELVVALEEVYRYSFYQNKF----HFIETIVLENKGKIVASG-GNQKDFSLGLKKALEGFFAENYR----- 198 Helicobacter pylori
15794192 150 AGYVLYGPQTQLVFTFGHGVYMFTLNAEN-EFVLTKEKPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGETGTRgKN 228 Neisseria meningiti...
15676944 150 AGYVLYGPQTQLVFTFGHGVYMFTLNAEN-EFVLTKENPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGETGTRgKN 228 Neisseria meningiti...
15600303 161 AGYAIYGPQTMLMLTLGNGVKGFTLDRELGSFVLTHDNISVPESTAEFAINMSNQRHWEAPVKRYVEELLAGKEGPLgKN 240 Pseudomonas aerugin...
17546845 158 AGYAVYGPQTTLVLTVGNGVHMFTLDREVGSFILTNRDVKIPADTKEFAINMSNMRHWAPPVRRYIDECLAGTEGPRgKD 237 Ralstonia solanacearum
11386864 129 SLYVVFGHKIELVVALEEVYRYAFYQNKF----HFIETIVLENKGKIIASG-GNQKDFSLGLKKALEGFFAENYR----- 198 Helicobacter pylori...
17366758 235 FNMRWIASLVAETYRILIR-GGIFLYPADGRKGysQGRLRLVYEANPIAFIIENAGGAAT----TSIDRILDLVPENLHQ 309 Sinorhizobium meliloti
17988767 245 FNMRWLGAAVGDMHRIMQR-GGLFFYVNDSRPGyeKGRLRLVYEANPIAFLAREAGGKAT----DGSRPILDIVPQTYHE 319 Brucella melitensis
16125634 240 FNMRWVASMVADVHRIMMR-GGVFMYPWDAREPdkPGKLRLMYEANPMSLLAERAGGKSI----EGLNEILDINPAKLHQ 314 Caulobacter crescen...
15792178 187 --LRYSGAMVSDINQILLKgGGIFSYPATQDAP--NGKLRAFFEVFPLAFIIEKAGGKTTn---GKNRSLLELEFDKIHA 259 Campylobacter jejuni
3913634  199 --LRYSGSMVADVHHVLVKkGGMFSYP----Q----KKLRKLFEVFPLALMVEKAKGEAFyfdkGVKKRLLEQSVENYHE 268 Helicobacter pylori
15794192 229 YNMRWVASMVAEIHRILMR-GGVFMYPQDKRDPskPGKLRLMYEANPMALILEQAGASAS----NARQDILGIRPESLHQ 303 Neisseria meningiti...
15676944 229 YNMRWVASMVAEIHRILMR-GGVFMYPQDKRDPakPGKLRLMYEANPMSLILEQAGASAS----NAYQAMLDIQPENLHQ 303 Neisseria meningiti...
15600303 241 YNMRWIASMVADVHRILTR-GGVFMYPRDAREPekPGKLRLMYEANPMSFIIEQAGGAAT----NGTQRILDIKPENLHQ 315 Pseudomonas aerugin...
17546845 238 FNMRWIASMVADVHRILTR-GGIFMYPWDKREPgkAGKLRLMYEANPMAFLVEQAGGAAT----NGHQRILEIQPEKLHQ 312 Ralstonia solanacearum
11386864 199 --LRYSGSMVADVHHVLVKkGGMFSYP----Q----KKLRKLFEVFPLALMVEKAKGEAFyfdkGVKKRLLDQSVESYHE 268 Helicobacter pylori...
17366758 310 RVPLVFGSRREVARITRYHVDPN 332 Sinorhizobium meliloti
17988767 320 RSALVFGVAEEVDILGEYFVK-- 340 Brucella melitensis
16125634 315 RVPVVLGSANEVEVIRAEMRAG- 336 Caulobacter crescentus CB15
15792178 260 TTPCFFGSEYEISKLLKAYNE-- 280 Campylobacter jejuni
3913634  269 KSECYLASQHEAHILEKYLKGE- 290 Helicobacter pylori
15794192 304 RVAVIMGSSEEVDYLNRLHSK-- 324 Neisseria meningitidis Z2491
15676944 304 RVAVFMGSSEEVAYLDRLHAK-- 324 Neisseria meningitidis MC58
15600303 316 RVAVFLGSKQEVERITGYHAE-- 336 Pseudomonas aeruginosa PA01
17546845 313 RVAVILGSKNEVDRVTQYHREAQ 335 Ralstonia solanacearum
11386864 269 KSECYLASPHEAQILEKHLKGE- 290 Helicobacter pylori J99
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap