Conserved Protein Domain Family
RRM

?
COG0724: RRM 
RNA recognition motif (RRM) domain [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 223796
View PSSM: COG0724
Aligned: 121 rows
Threshold Bit Score: 33.767
Threshold Setting Gi: 2497065
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2497065   244 YLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTEN 323  baker's yeast
19073946    1 --------------------------------MISKLFVSNFPESYSEESMSLIFNPFGEIKSIKILREPRLFSIIEFQE 48   Encephalitozoon c...
19173378    2 LCMAAGGGIYDKKALPSRMRIVVKNLPASTTKEEIEKEFSRHGKITDVFMARNEQGKFRRICFVGYMEEKDGVEAIRYRD 81   Encephalitozoon c...
19074720   78 LHNRQIRVMKKDERPPETGNIFVKNLPEDFTGKDLDDAFSMFGEIVSCKVATTSHGKSKGYGFVQFKEKKAAKKVIKNFS 157  Encephalitozoon c...
3123239   151 CRIMWSQRDPSLRKMGTGNVFIKNLDPAIDNKALHDT-FSAFGKILSCKVAVDELGNAKGYGFVHFDSVESANAAIEHVN 229  fission yeast
6016322     1 --------------------MSSSKSLDWADDEDYGTGLPSIQTFDNPDGTKTMIEFRIDDNGKKVKVTRVIRKTVITER 60   fission yeast
417441    109 CRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDT-FSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALN 187  baker's yeast
417810      1 ---------------------------------MSAEIEEATNAVNNLSINDSEQQPRAPTHKTVIDPEDTIFIGNVAHE 47   baker's yeast
6324532    28 SCGPINKLEVKSKTRTVLPDSKKRERAAEADQEEKEASKPDVSDEQTEEVALPKVKKAKKSKRNDEDEDLEARYYAKLLN 107  baker's yeast
115936     33 KRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNM 112  baker's yeast
2497065   324 AEEADITNGSTMISASLHHNIANKDATRSIIIEfksPveKSDLFKKKLQfldrsknkryilesidlvntdvpsnqfpeny 403  baker's yeast
19073946   49 PLDAKAAMDSLGGRRVYGHNEPLHIEMAFDRK--------KRVAVSGIP------------------------------- 89   Encephalitozoon c...
19173378   82 GSLFKNQRIACEEVREGSPEIGESEERMIKYS--------RKIFIRNVP------------------------------- 122  Encephalitozoon c...
19074720  158 SLDGLLLGGNRIVVELYN-PEIKKGESKKTSA----T--FTNCFIKNFP------------------------------- 199  Encephalitozoon c...
3123239   230 GMLLNDKKVYVGHHVSRRERQSKVEALKANF---------TNVYIKNLD------------------------------- 269  fission yeast
6016322    61 VQHAVAERKKWKKFGKEAGKNSGVDARTTSVG-------ENVQLRLQLG------------------------------- 102  fission yeast
417441    188 GMLLNGQEIYVAPHLSRKERDSQLEETKAHY---------TNLYVKNIN------------------------------- 227  baker's yeast
417810     48 CTEDDLKQLFVEEFGDEVSVEIPIKEHTDGHIP------ASKHALVKFP------------------------------- 90   baker's yeast
6324532   108 EEAEAEDDKPTVTKTDETSVPLTSAAKKVDFKEdelEkaERTVFIGNILs------------------------------ 157  baker's yeast
115936    113 EFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHgkrLdlKHRLFLYTMKdveryn------------------------- 167  baker's yeast
2497065   404 avltflNISMAIEVLDYLKKYSKNlgiskcfyvslaplvvssarssvaniyegktsthrlsvpsvtagnnndsnnngnnn 483  baker's yeast
19073946   90 ------SDSSKEEVLKFFQYYGSV-------------------------------------------------------- 107  Encephalitozoon c...
19173378  123 ------AEANEQFVRDVFKEYGEIeevgll-------------------------------------------------- 146  Encephalitozoon c...
19074720  200 ------FDASEAELLELLERYGKV-------------------------------------------------------- 217  Encephalitozoon c...
3123239   270 ------TEITEQEFSDLFGQFGEI-------------------------------------------------------- 287  fission yeast
6016322   103 ------WTTTKEEEQDEAALAAAK-------------------------------------------------------- 120  fission yeast
417441    228 ------SETTDEQFQELFAKFGPI-------------------------------------------------------- 245  baker's yeast
417810     91 ------TKIDFDNIKENYDTKVVKd------------------------------------------------------- 109  baker's yeast
6324532   158 ------TVITSKKVYKEFKKLFGTn------------------------------------------------------- 176  baker's yeast
115936    168 -sddfdTEFREPDMPTFVPSSSLKswlmddkvrdqfvlqddvktsvfwnsmfneedslvesrenwstnyvrfspkgtylf 246  baker's yeast
2497065   484 ksnmsgittlnnnssigvsvyghsnmsltslsSSVSLNEEIdmlatkLQGVELDGTYLEINYRDYQTPTIEEHSthlsnv 563  baker's yeast
19073946  108 -----------------------------------EN-ITH--------GDDMQTIFIDFSSQQDAESFLELDQ------ 137  Encephalitozoon c...
19173378  147 ---------------------------drregKGAYVKFSRge---cALEAYRKVQFIGGVKARMCPWKDRAEKrqy--- 193  Encephalitozoon c...
19074720  218 --------------------------------TSLFFPVK-------DNGKPKGFAFANFENHESALNAIKNLHg----- 253  Encephalitozoon c...
3123239   288 --------------------------------TSLSLVKD-------QNDKPRGFGFVNYANHECAQKAVDELN------ 322  fission yeast
6016322   121 ----------------------------------VKAKGSS-------VVRCRACKGNHFTAQCPYKSIIGPVD------ 153  fission yeast
417441    246 --------------------------------VSASLEKD-------ADGKLKGFGFVNYEKHEDAVKAVEALN------ 280  baker's yeast
417810    110 --------------------------------REIHIKRAR------TPGQMQRGGFRGRGGFRGRGGFRGGFR------ 145  baker's yeast
6324532   177 -------------------------------pIAETEESGNe----kEEESSKKSDNNEFAIESIRFRSISFDEal---- 217  baker's yeast
115936    247 syhqqgvtawggpnfdrlrrfyhpdvrnssvspnekylvtfstepiiveednefspftkkneghqlciwdiasgllmatf 326  baker's yeast
2497065   564 kiskttensrqfsqdipsplplnehmfmndsnqsngaiipqqliatpspvspNLQMNQRVLPNPITQSleqnfnvsakva 643  baker's yeast
19073946  138 ----------------------------------------------------KISFGKEKCRLSIKP------------- 152  Encephalitozoon c...
19173378  194 -------------------------------------------------ehyNTLFFSFESIVKRICEs----------- 213  Encephalitozoon c...
19074720  254 ----------------------------------------------------TFPFGAGRDGTGEAFYi----------- 270  Encephalitozoon c...
3123239   323 ----------------------------------------------------DKEYKGKKLYVGR--------------- 335  fission yeast
6016322   154 ----------------------------------------------------EPPLDASPVSSRASGAl----------- 170  fission yeast
417441    281 ----------------------------------------------------DSELNGEKLYVGR--------------- 293  baker's yeast
417810    146 ----------------------------------------------------GGYRGGFRGRGNFR-------------- 159  baker's yeast
6324532   218 --------------------------------------------------prKVAFVQQKFHKSRDTIn----------- 236  baker's yeast
115936    327 pvikspylkwplvrwsyndkycarmvgdslivhdatknfmpleakalkpsgirdfsfapegvklqpfrngdepsvllayw 406  baker's yeast
2497065   644 ssmgsdignrtiyigNINPRSKAEDIcnvvrggilqsikyipekkicfvtfieapsAVQFYANSFidpivlhgnmlrvgw 723  baker's yeast
19073946  153 ----------------FTKRERKD----------------------------------SVLSPER--------------- 167  Encephalitozoon c...
19173378  214 --------------eRVSIRDVVDVNdkdlgar----------------mariethLVQETKKFLe-------------- 249  Encephalitozoon c...
19074720  271 ---------------qKGQRKEER---------------------------------AEELRKMF--------------- 287  Encephalitozoon c...
3123239   336 ----------------AQKKHERE--------------------------------EELRKRYEQ--------------- 352  fission yeast
6016322   171 --------------gEKGRYIAPHLR-------------------------------AGSGRESG--------------- 190  fission yeast
417441    294 ----------------AQKKNERM--------------------------------HVLKKQYEA--------------- 310  baker's yeast
417810    160 ---------------GRGGARGGFNG-----------------------------------QKRE--------------- 174  baker's yeast
6324532   237 ----------------AYIVYKNKSAvrk------------------------icsNLNAVVFQDhhl------------ 264  baker's yeast
115936    407 tpetnnsactatiaevprgrvlktvnlvqvsnvtlhwqnqaeflcfnverhtksgktqfsnlqicrlterdipvekvelk 486  baker's yeast
2497065   724 ghysgplpklislavtigasrnvyvslpeFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIeqinylsdshccw 803  baker's yeast
19073946  168 -----------------------------SVFIYNLSPRTTRTDLADLFVKFGEIRSLGILSGGKAF------------- 205  Encephalitozoon c...
19173378  250 -----------------------------SNGIYLDHLTGSVDRNMLIVRNMELMKCLDLVDDRCKIsv----------- 289  Encephalitozoon c...
19074720  288 -----------------------------EQMSMQGQSYKKNLYITNIPEGFGCEELGSIFKEFGNI------------- 325  Encephalitozoon c...
3123239   353 -----------------------------MKLEKMNKYQGVNLFIKNLQDEVDDERLKAEFSAFGTI------------- 390  fission yeast
6016322   191 -----------------------------DSMFKRERDDSATLRVTNLSDDTREEELRDLFRRFGGIqr----------- 230  fission yeast
417441    311 -----------------------------YRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTI------------- 348  baker's yeast
417810    175 -----------------------------KIPLDQMERSKDTLYINNVPFKATKEEVAEFFGTDADSis----------- 214  baker's yeast
6324532   265 --------------------------rvdSVAHPAPHDKKRSIFVGNLDFEEIEESLWKHFEPCGDIey----------- 307  baker's yeast
115936    487 dsvfefgwephgnrfvtisvhevadmnyaipantirfyapetkektdvikrwslvkeipktfantvswspagrfvvvgal 566  baker's yeast
2497065   804 infmnISSAISLVEEMNKESTVQNeSGEVTLKRATEEKFGgrykgllinygkdrcgnINKNLIAGKNSRFYKKVKRP 880  baker's yeast
19073946  206 -----VNYDKELSALKAIRHMDGKsVGGKKIRIALKSMKK-----------------GLHRHV-------------- 246  Encephalitozoon cuni...
19173378  290 ----aPSKCLALLKFDKEEDARRCyRKLSLKRVKEHVVYC-----------------EYAPICSVPESTGEEPSKRP 345  Encephalitozoon cuni...
19074720  326 -----TSISVGVDGANS-QKQYAY-ICYSTPEEASIAVER-----------------GNEIYLDGNRLQVAYFKNKL 378  Encephalitozoon cuni...
3123239   391 -----TSAKIMTDEQGK-SKGFGF-VCYTTPEEANKAVTE-----------------MNQRMLAGKPLYVALAQRKE 443  fission yeast
6016322   231 ----vYLAKDKETGRAKGFAFVSYyDRDCAIKARDRLDGY-----------------GWNNLILRCEFSKPRD---- 282  fission yeast
417441    349 -----TSAKVMRTENGK-SKGFGF-VCFSTPEEATKAITE-----------------KNQQIVAGKPLYVAIAQRKD 401  baker's yeast
417810    215 ----lPMRKMRDQHTGRIFTSDSAnRGMAFVTFSGENVDI-----------------EAKAEEFKGKVFGDRELTVD 270  baker's yeast
6324532   308 ----vRIIRDSKTNMGKGFAYVQFkDLQSVNKALLLNEKP-----------------MKSQKQEDENTKKPTKKARK 363  baker's yeast
115936    567 vgpnmrrsdlqfydmdypgeknindnndvsaslkdvahptysaatnitwdpsgryvtawssslkhkvehgykifnia 643  baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap