1K32


Conserved Protein Domain Family
CtpA

?
COG0793: CtpA 
Click on image for an interactive view with Cn3D
C-terminal processing protease CtpA/Prc, contains a PDZ domain [Posttranslational modification, protein turnover, chaperones]
linked to 3D-structure
Statistics
?
PSSM-Id: 223864
View PSSM: COG0793
Aligned: 56 rows
Threshold Bit Score: 242.623
Threshold Setting Gi: 16126271
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K32_A    649 KRPLVSSIHEEFLQMYD--------------EAWKLARDNYWNEAVAKEISERIYEKYRN--------LVPLCKTRy--- 703  Thermoplasma acid...
16126271   13 FLLASPALAESPFWPVQpk-----------nGPVAAELRGAWKSRGYGWIVQFGPDGPQLfhtaggacYPDPRREPd--- 78   Caulobacter cresc...
15806326   17 ALLLAPSSVAATSPGVQapaq------aaavPSAPAIAADAPAQQIFDEVNELLNERYGGlspvnrpaLTREYQQRlnav 90   Deinococcus radio...
15806503    8 PPARVSRWRRLGATLLTg------------aTLAATNAAASPASDLYAAATKAVRDNYHGwstqnfrsLETQYARQlara 75   Deinococcus radio...
18312539  633 rvkvyvepeKEWRQMFR--------------EAWLLMRENYWRGDLNGVDWDAVYKKYEP--------LLSRIGTRy--- 687  Pyrobaculum aerop...
16264799    8 GLLAGFLLLLVPTQGFG--------------LDLPRSGHPIFDRVVTLVADNFHDPSALDgfg---aaVRQELDGGdpl- 69   Sinorhizobium mel...
11387136  686 RVKVYVEPEKEWRQMLR--------------ETWKLMKQNYWN-EERLKNWDSILPKYER--------LLDRISTRf--- 739  Sulfolobus solfat...
20140383  635 aitIVSNVKEDFAEMYD--------------EAWKLARDNYWDKEHALTISEKIYERYRK--------LVERCVTRw--- 689  Thermoplasma volc...
15600816    1 ---MRASLFVMKPRLIS---------------IFVQKFAYLFDHVWRLTQTKFYDPQMHG--------VDWQQYGD---- 50   Vibrio cholerae
15838452   73 QLPRFDSDGQKTSPIINdmlsllevshlqhfPAFMVSEEKKKTAVLANYFPELRDISGMVmvmdmlprISRVLSLEtwsp 152  Xylella fastidios...
1K32_A    704 ------DLSNVIVEMQGEYRTSHSYEMGGTFTDKDPFR----------SGRIACDF--------KLDG--DHYVVAKAy- 756  Thermoplasma acid...
16126271   79 -----pDGVLALWRAEGPGVISLTGDPVGTRYQFDRLP----------NLPTDCIS--------AGGWtpDRIVAFAAdt 135  Caulobacter cresc...
15806326   91 ctpqprTCPEDKAYPVLEAELTALGDEHSFFQTPEDYQ----------DFVTSATGg-------SRQQfgVKLAKFDG-- 151  Deinococcus radio...
15806503   76 cepqgeACSYDTGRAVLSELLADFGDAHTYVRDPEGAAr---------YRESEQER--------VVPRtgLRLARVQ--- 135  Deinococcus radio...
18312539  688 ------ELSDLINEMQGELGTSHAYEIVPDFEVDKPYL----------IGGLGAEF--------KWDG--KCWRIAKIf- 740  Pyrobaculum aerop...
16264799   70 ----naKSTEPRVDAAIERILASLDASHTARFTQDSIAyyeladifryAIRHDMKRlfppdgraSYAGvgMVTRMEN--- 142  Sinorhizobium mel...
11387136  740 ------ELSDVIQEMQGETRTSHSYETAYDYDTPEPLS----------VGGLGAEF--------EYDEsnKCYKITKIy- 794  Sulfolobus solfat...
20140383  690 ------DLSYLITEIQGEYRTSHSYEMGGYFTDIDMPR----------AGRIACDF--------KYSN--GEYVISDIl- 742  Thermoplasma volc...
15600816   51 ------LYRKHLPSIRTYSDFAELLSEMVGDLNVSHTGa--------fFMAGNSSWe-------EPASlgLYYDDRYRg- 108  Vibrio cholerae
15838452  153 lythgvRVGDRILLETLDTDISDKNKPVRLYCYHINTAgv------kkEFEFDLPAp-------PLGTqqTAVPAGDHvl 219  Xylella fastidios...
1K32_A    757 ----------AGDYSNEGEKSPIFEYGId-P-TGYLIEDID------GETVGAGS-----N-IYR--VLSEKAGTSARIR 810  Thermoplasma acid...
16126271  136 f-------aeLYPRSAERKLDWPARKAKalTqVGPNATDDQlwlamaGLLSGLDDphvelHgMVQgaRRDLEPGESPTLM 208  Caulobacter cresc...
15806326  152 ----------ENRLVLEVVPEGAAEGAG--LrRGDVLKTID------GAAFTYSD---------L--QKARREGRLLRLG 202  Deinococcus radio...
15806503  136 ----------GGLLVASVAAGSPADLLG--VrRFDLITQVNgqpvggPIPTGQVApagdfGpNDF--ARLERTGQAIDLT 201  Deinococcus radio...
18312539  741 ----------VGDPSYENEKSPLLAPGVd-VrEGDCIISIA------GVRLGPNA-----PpEYA--LLNRTS--DVVTV 794  Pyrobaculum aerop...
16264799  143 ----------GLPFVSDVYDGSPADKAG--IrVGDEVLSVD------GAPYREI---------E---SFRGRTGQKVEIR 192  Sinorhizobium mel...
11387136  795 ----------VGDSTNENERSPLRDPGVq-LnVGDCIKNID------GEDANGN--------IYS--HLINKD--QVILD 845  Sulfolobus solfat...
20140383  743 ----------YGDPSNENEKSPFLLSTLd-AdIGDAVIEID------GIPIGKGK-----S-IYE--ALVGKGNRSVLVK 797  Thermoplasma volc...
15600816  109 ----------KGVRVKSLLPGGPADTYQspIkAGAIIYSVN------GKEISDQQd------IYP--FLNFTQGKLTRLS 164  Vibrio cholerae
15838452  220 hitrfdqgeiQALKHVSEDRNSSITQLHy-IsLGAVTTALHl----pKNKVIDVVkdseaDkAGV--EIGSIIGNGTNIK 292  Xylella fastidios...
1K32_A    811 LSGKg---GDKRDLMIDILDDDRFIRYRSWVEAnr--------ryVHERSKGTIGYIHIPDMGMMGLN---------EFY 870  Thermoplasma acid...
16126271  209 RVRAad-pSGDERGWLQAYREGILTGLLQGKGRqaa------nnrIFWGRVDDVGYLNVLTMGAFARNaapddprplDAV 281  Caulobacter cresc...
15806326  203 IERQ------GQPLEVSLQARESSTRDLPRMS-------------FVGPRS-DVALIRIPTFLTGGGv---------AQR 253  Deinococcus radio...
15806503  202 LRRAg-----ESEQTVKVIGLPMPASDRPAP--------------VWAGAEGRVAVIDLPSFLSTDTAaa------fLAQ 256  Deinococcus radio...
18312539  795 EVERg---GEVKAFTVRTVRDEKYLIYRHWVEAnr--------ryVHQRTGGAVGYIHIPDMGPAGYA---------EFF 854  Pyrobaculum aerop...
16264799  193 LRRN----AGAQPFTTSVAVERLRPLPTFEKAIens------vsvNVSDGR-RIGYLRLWTLSSPDGl---------DIA 252  Sinorhizobium mel...
11387136  846 VITAd---GKNKRVTVKVLKDERFLIYRYWVEKnr--------eyVHEKSKGRLGYIHIPDMMYQGFA---------EFY 905  Sulfolobus solfat...
20140383  798 IRKKd---NSVRSGFVDVLQDDRYIRYRAWVEKnk--------kfVHERTNGRIGYIHIPDMGIMGLN---------EFY 857  Thermoplasma volc...
15600816  165 VLVPgeekAQNFTLVPITLEEESELLYEQWVEQrr--------alVETLSDGRLGYVHLAAMDAASFEq-------mQND 229  Vibrio cholerae
15838452  293 AGPEn---IGGKKVIKTNSRYEVVLPDGRKVTFsinkiipklndfEGIRSAQLIGQTLVIAFNEMSDEn-------tQWA 362  Xylella fastidios...
1K32_A    871 R-LFINESs---YQGLIVDVRFNGGGFVSQLIIEKLMNK----RIGYDNPRRGTLSPYPTNSV---------------RG 927  Thermoplasma acid...
16126271  282 LdEALSAFv--gAKAVVVDVSNNRGGYDIISRRIAARFTaq-pRVAYAKVPVGAKAPPQVIKVepsg-------avgfTG 351  Caulobacter cresc...
15806326  254 VhDLVNQAervgAQGVIVDLRGNTGGSLSECDSAVGAFVpsftRVAQNADGQSRTTVQQGRRLedgvssgsvrrpqlwTG 333  Deinococcus radio...
15806503  257 VrQLQAAG----VRSLIVDLRFNGGGNLQQCVAAASIFGpvvyNASYAVGGFSYSGLDGREGAyldtvfa-spsrrvwNG 331  Deinococcus radio...
18312539  855 K-SLNAEGd---KEAFIIDVRYNRGGHTSGMLILRASVG----IFGRFLTRYFKPYPYPELVL---------------PR 911  Pyrobaculum aerop...
16264799  253 ArELATGRlk-dADGVVVDLRGRWGGGPPDAAELFVGDT----PNFRLISRSGKDMLANVRWR----------------R 311  Sinorhizobium mel...
11387136  906 R-LFMSEFh---REGLVVDVRFNRGGFVSGLLLEKLLLK----RVGYDYPRNGKPIPMPYFSS---------------PK 962  Sulfolobus solfat...
20140383  858 R-QYVTEAs---RNGLIVDVRFNGGGFVSQLILEKLYMK----RLGYDNPRRGTLEPYPMNSI---------------EG 914  Thermoplasma volc...
15600816  230 MfGLEKDK-----LGLVVDVRFNAGGWLHDQVMEILSGT----RHSVMQTRDGYVVSSFPERRw--------------AK 286  Vibrio cholerae
15838452  363 LqQIKNTP----ATAIVLDLRSNTGGSGIAGEKLLAGFLps-gTRIATEIRGKKTNVINVPSGyt-----------ptDK 426  Xylella fastidios...
1K32_A    928 KIIAITNEYAGSDGDIFSFSFKKLGLGKLIGtRTWGGVVGITP-KRRLiDGTVLTQPEFAFWFRDAGFGVENYGVDPDVE 1006 Thermoplasma acid...
16126271  352 PVYVVTSDITVSAGETFTLMMKALPNVTLVG-GTTRGAFSDQL-PKPL-PNGWTLALPAELYRTADGRDLEGRGLAPTVP 428  Caulobacter cresc...
15806326  334 PLAVLVNEVSASCSEFFAYEVQYARRGPVIG-ETTAGVGNTATrVFPVg-ERAALQLTLTHYVKPGGQPYPVR-VTPDEL 410  Deinococcus radio...
15806503  332 PAAVLIGPDTASCAEVFAYYAQ-KGGARLVG-EATKGVANSGVlLRNLp-DGGLIAVTVFRGYASGDVALPAR-LTPDVP 407  Deinococcus radio...
18312539  912 RLVLVTNEHAGSDGDIFTYDFKRLKLGPVVGkRTWGGTVGIDT-RYKLvDGTIITQPKYAFWADDVGTGIEGSGVEPDVE 990  Pyrobaculum aerop...
16264799  312 PVVAIIDEGSRSGLELFAYALK-ANGIPLVG-TRTAGALLAGR-AYLL-PDDSMLELAVSDAVIDDGVRLEGRGVEPDVP 387  Sinorhizobium mel...
11387136  963 VLVGITNEHAGSDGDIFSFLFKKYKLGVLIGrRTWGGVVGIRP-RYRLvDKTYISQPEFAVNFEDVGFGIENYGVDPDIV 1041 Sulfolobus solfat...
20140383  915 PMIAITNEYAGSDGDIFSYSFKALHLGTLIGtRTWGGVVGISP-RRKLiDGTVLSQPEYAFWFKGSGFSVENYGVDPDVV 993  Thermoplasma volc...
15600816  287 PSIMLANADSYSDGSIVPYFYQKEGLGKLVG-ERVPGTGTAVI-WEQQqEPGLIYGVPQLGIKDEQGRWFENQEIIPDIL 364  Vibrio cholerae
15838452  427 PMAVLISLLSSSGAELAARTLQFHHRARIYG-AQSSGQLLASR-FYKL-TDGTYMQIADTNLLDPAGKPLEWYGVMPDVK 503  Xylella fastidios...
1K32_A   1007 IEYA-----PHDYLSGKDPQIDYAIDALIEELRNwNEELPQRPS 1045 Thermoplasma acidophilum
16126271  429 MAVFpdsdlMGGHAKALSSLFATIREGAAAGATR---------- 462  Caulobacter crescentus CB15
15806326  411 RPEGdd--eLRHLSQGDDVLLRAGLAALSTAP---TLAVDRK-- 447  Deinococcus radiodurans
15806503  408 APLDi----DLLTTQGRDTGLEAALIVLGEAVT--SPPTLTTSP 445  Deinococcus radiodurans
18312539  991 VEIA-----PHEYREGRDTQLEKAIQIIEKK------------- 1016 Pyrobaculum aerophilum
16264799  388 VPFA------LPYAGGRDPQREAAMEEMRRILAKg--------- 416  Sinorhizobium meliloti
11387136 1042 VEIK-----PDDYVNNRDTQLDTAIELALKQL------------ 1068 Sulfolobus solfataricus
20140383  994 IEYP-----PEMYNVNVDPQLERAIEMVLADLEKyKIELPKK-- 1030 Thermoplasma volcanium
15600816  365 VYND-----PESVVAGEDRQLAAAVEALLLEISSk--------- 394  Vibrio cholerae
15838452  504 KWKA-----LSDVRAGRDPVLECALTDLSGGQCH---------- 532  Xylella fastidiosa 9a5c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap