Conserved Protein Domain Family
GcvP2

?
COG1003: GcvP2 
Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 223935
View PSSM: COG1003
Aligned: 36 rows
Threshold Bit Score: 625.474
Threshold Setting Gi: 15790563
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15837986 463 DAITADALPAGLLRSS-----------------AFLTHPVFNTH------HSEHELLRYLRMLADKDLAMDRTMIPLGSC 519  Xylella fastidiosa...
14521976   4 QAKWDEPLIFELSRPGrvgytlp---kpiedvdVEIPEKLKRKSplnlpeVSEPEVVKHYTRLSEMNYGVDSGIYPLGSC 80   Pyrococcus abyssi
14591728   4 QARWDEPLIFELSRPGrvgytlp---kpiedvkVEIPEKLKRKTplelpeVSEPEVVKHYTRLSEMNYGVDSGIYPLGSC 80   Pyrococcus horikoshii
15927115   1 MTSKSSPLIFERSREGryayslpksdiktnsveSLLDDKFIRKNkaefpeVAELDLVRHYTELSNKNFGVDNGFYPLGSC 80   Staphylococcus aur...
15642987   1 ------MTIFERSKKGrkafrlp----esdipeYSLPDRFLRRTppelpeVSEPDLVRHYTNLARKNYSVDLGIYPLGSC 70   Thermotoga maritima
13541129   5 QAYYEEPIIKDIK--Ssntfsl-----seqvdeSILPENLKRKDlel-peVSEYDVVRHYTRLSQMNYTVDVGIYPLGSC 76   Thermoplasma volca...
16082341   5 QAYYDEPLIKDIK--Sdtsfkl-----sedvdeNLLPQDMRRTDlkl-pqVSEVDVVRHYTRLSQMNYTVDVGIYPLGSC 76   Thermoplasma acido...
15790563   1 MEHYEQARYAPAEGETnepllsen-dqttvsvdPSLPDDLTRDTvel-psLEEPELARHYVRLSQQNYGVDSGPYPLGSC 78   Halobacterium sp. ...
15606927   1 -----MELIFEKSKKGrkgyklpeldveevnikEYLPEEYLREEldf-peVSELDVVRHYTNLSHLNYAVDTTMVPLGSC 74   Aquifex aeolicus
16800455   2 NLEETMPLVFERSIPGrigfslpesdvpetnagDYFDEAYLRSTpadlpeLSELEIMRHYTNLSNHNFGVDSGFYPLGSC 81   Listeria innocua
15837986 520 TMKLNATAEMIPVTWQEFACIHPLAPAVQWSGYRQLIDELEAMLAECTGYDAISLQPNSGAQGEYAGLLAIRAYHRSRGE 599  Xylella fastidiosa...
14521976  81 TMKYNPKINEELAGHPKVAYIHPYQDERTVQGALRIMWELEQWLKEITGMDRFTLQPAAGANGEFTGVMIIKAYHLDRGE 160  Pyrococcus abyssi
14591728  81 TMKYNPKINEEIANHPKVAFIHPYQDERTVQGALKIMWELEQWLKEITGMDRFTLQPAAGANGEFTGVMIIKAYHLDRGD 160  Pyrococcus horikoshii
15927115  81 TMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSLQEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGE 160  Staphylococcus aur...
15642987  71 TMKYNPKLNEKAANLEGFREIHPYQPVETVQGSLRLMYELKKMLCEITGMDDMTLQPAAGAHGELTGMLIVREYFKNRGD 150  Thermotoga maritima
13541129  77 TMKYNPKFADRVSAIDGFRNIHPFQPENTVQGALHVMYDLQEYLKKISDMDAVSLQPMAGADGEFTGILIVKKYFEDKGE 156  Thermoplasma volca...
16082341  77 TMKYNPKYADRIASFAEFRNIHPFQPESTVQGTLQIMYELQEFLKKISDMDAVTLQPMAGADGEFTGILIIKKYFEDLHE 156  Thermoplasma acido...
15790563  79 TMKYNPRFTEDAAALP-AAAVHPDRSETALQGTLAVMHDLQDYLGRIGGMDAVTLQPPAGAAGEFTGILIAEAYHEATDG 157  Halobacterium sp. ...
15606927  75 TMKYNPRINEELVNKKEFLNVHPLTPEEYIQPLLKLVYELKELLKELGGFAEVSLQPAAGAHGELLGLLLIHAYHQDRGN 154  Aquifex aeolicus
16800455  82 TMKYNPKINEKVARFPGFANIHPNQPESSVQGALELLYDLQTSLVEITGMDEVTLQPAAGAHGEWTGLMLIRAFHEKNGD 161  Listeria innocua
15837986 600 ERRNVCLIPESAHGTNPASAQLCGMQVVIIKCDRSGNVDVDDLRMKAEkysDSLAALMVTYPSTHGVFEEAITEICEIVH 679  Xylella fastidiosa...
14521976 161 TQRNEMLVPDSAHGTNPASAAMAGFKVIEIPSNENGTVDLEALENAVS---ERTAGLMLTNPNTLGIFEDEIEEIAKIVH 237  Pyrococcus abyssi
14591728 161 TQRTEILVPDSAHGTNPASASMAGFKVVEIPSNENGTVDLEALENAVS---ERTAGLMLTNPNTLGIFEDEIEEIAKIVH 237  Pyrococcus horikoshii
15927115 161 GHRDEVIVPDSAHGTNPASASFAGFKSVTVKSNERGEVDIDDLKRVVN---ENTAAIMLTNPNTLGIFEKNIMEIREIVH 237  Staphylococcus aur...
15642987 151 TGRKKVLVPDSAHGTNPASASMVGFEVVEIKS-KNGMVDVEDLKKLLD---EEVAAVMLTNPNTLGLFEKDILKIAEMTH 226  Thermotoga maritima
13541129 157 -DRTEIIIPDSAHGTNPASATMGGFDVVEVPSDDKGMVDLEALRAAVS---KKTAAFMITNPNTLGIFEQNIEEIAKIIH 232  Thermoplasma volca...
16082341 157 -DRTEIIVPDSAHGTNPASATMGGFDVVEIPSNSEGMVDLNALKAAIS---KKTAALMITNPNTLGIFEQNITEIAKILH 232  Thermoplasma acido...
15790563 158 GHRNEVIVPDAAHGTNFASAALGGYDVIELPSGDDGRVDLDALEAALG---ENTAALMLTNPNTLGLFERDIEPIAEMVH 234  Halobacterium sp. ...
15606927 155 KEKKVVLIPDSAHGTNPASAAICGFDIKVVKSDKKGELDFEDFIKKLD---ERVAALMITNPNTLGIFERKIKEIAEELH 231  Aquifex aeolicus
16800455 162 TKRTKVIIPDSAHGTNPASAAVAGFDVVTVKSNEKGLVDVADLKKVVG---EDTAALMLTNPNTLGLFEKDIVEMAEIVH 238  Listeria innocua
15837986 680 AHGGQVYTDGANMNALVGVAKPGRWGSDVSHLNLHKTFCIPHGGGGPGVGPCAVKAHLAPFLPKTLpLPgdAAGL-PVQG 758  Xylella fastidiosa...
14521976 238 KAGGLLYYDGANLNGILGKVRPGDMGFDIVHLNLHKTFSTPHGGGGPGAGPVGVKEFLKDYLPVPLvSYdeENDRyYLDY 317  Pyrococcus abyssi
14591728 238 KVGGLLYYDGANLNGILGKVRPGDMGFDIVHLNLHKTFSTPHGGGGPGAGPVGVKEFLKDYLPVPLvSYdeENDRyYLDY 317  Pyrococcus horikoshii
15927115 238 NAGGLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLPKPMvIK--DGDKfKYDN 315  Staphylococcus aur...
15642987 227 ECGALLYYDGANLNAIMGKVRPGDMGFDIVHLNLHKTFSTPHGMGGPGSGPVGVKKHLVDFLPFPQvK---KNGElY-EL 302  Thermotoga maritima
13541129 233 NAGALLYYDGANLNAIFGITSPGLMGFDIVHFNLHKSFATPHGGGGPGAGPVAVKSFLKDFLPVPIvDF--DGNSyRLNY 310  Thermoplasma volca...
16082341 233 DAGALLYYDGANLNAIFGITSPGLMGFDIVHFNLHKSFATPHGGGGPGAGPVAVKSFLSDFLPVPVvGY--DGKRyFLDY 310  Thermoplasma acido...
15790563 235 DAGGLLYYDGANLNALLGRARPGDMGFDIMHFNVHKTFATPHGGGGPGAGPVGVTDELAGFLPDPHvRQs-AGGDyELYT 313  Halobacterium sp. ...
15606927 232 KRDALLYMDGANFNALVGRFKPGEWGVDVMHFNLHKTFSTPHGGGGPGAGPVGVSERLKPYLPVPQiEY--DGKKyYLNW 309  Aquifex aeolicus
16800455 239 AAGGKLYYDGANLNAIMAKVRPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPIGVKKELIPFLPTPVlTK--KDDAyTFDY 316  Listeria innocua
15837986 759 TQEaKVGMVSAANFGSASILPVSWMYITMMGAAGLRKATQVALLNANYIAKRLAP--HYKTLYTGRHglVAHECILDVRP 836  Xylella fastidiosa...
14521976 318 DVP-KSIGKVKELFGNFAVLVRALTYLKVMGKDGLREVSEVAVLNANYLARKLKGtrGYELPHKEL---RKHEVVFSAEP 393  Pyrococcus abyssi
14591728 318 NVP-KSIGKVKELFGNFAVLVKALTYLKIMGKEGLREVSEVAVLNANYLARKLKGtrGYELPHKEL---RKHEVVFSAEP 393  Pyrococcus horikoshii
15927115 316 DIK-NSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNANYIKARLSe--HFEIPYKQY---CKHEFVLSGV- 388  Staphylococcus aur...
15642987 303 FVPeKTIGRVRSFFGNFPVLVKAYTYILTMGRDGLERVSEMAVLNANYLKKKIEk--FLEIPYNGF---CMHEFVASAEK 377  Thermotoga maritima
13541129 311 ELK-KTIGKVSSFYGSFSILLRAWSYIIRNGDDGLKNVSARAVLNSNYLKKKLEK--YYDIPYYPL---KKHEFVLSTE- 383  Thermoplasma volca...
16082341 311 GKK-KSIGRVSSFYGSFSILLRAWSYVIRNGDDGLKNATIRAVLNSNYLKKKVEG--YYEVPYYPL---KKHEFVLSTE- 383  Thermoplasma acido...
15790563 314 PPR--SIGKVHGFQGNWPVLVKAFAYIDRLGDSGLADASAKAVLNANYLADQLD----YEIPLGPF----HHEFVASAG- 382  Halobacterium sp. ...
15606927 310 NIE-KSVGKILAFHGHFLVWLKALAYILTYGKD-IKKVSEYAVLNARYLKHLLKG--VFKDPYPESP--CMHEFVLSAT- 382  Aquifex aeolicus
16800455 317 NYP-DSIGRVKPYYGNFGINVRAYTYIRTMGPDGLKLVTEYAVLNANYMMRKLQd--AYDLPFDQV---CKHEFVLSGN- 389  Listeria innocua
15837986 837 LEKVSGVSAEDIAKRLIDFGFHAPTLSFP--VAGTLMVEPTESESQQELDRFVDAMIQIRGEIAAIEkGhlDPEDNPLKQ 914  Xylella fastidiosa...
14521976 394 MKRETGVRTLDVAKRLLDFGMHAPTIYFPliVHEALMIEPTETVSKEELDAYVEAMKKISEEAYTNP-E--VVKSAPHNT 470  Pyrococcus abyssi
14591728 394 MKKETGVRTLDVAKRLLDFGLHAPTIYFPliVHEALMIEPTESVSKEELDAYVEALKKISEEAYTNP-E--IVKSAPHNT 470  Pyrococcus horikoshii
15927115 389 RQKEFGVRTLDMAKRLLDFGVHPPTIYFPlnVEEGMMIEPTETESKETLDYFIDTLISIAEEAKNDP-D--KVLEAPHTT 465  Staphylococcus aur...
15642987 378 VFRETGVRTLDIAKRILDFGVHPPTVYFPliVPEALMIEPTETENKETLDKYAEILERVVKEAYENP-D--ALKNAPHNT 454  Thermotoga maritima
13541129 384 ---NTGKRALDIGKYILDNGIHSPTVYFPliVKEAMMIEPTETVSKADLDNYADVLIEALKLSDEE------LKSRPKNT 454  Thermoplasma volca...
16082341 384 ---KTGRRALDIGKYLLDFGIHSPTVYFPliVKEAMMIEPTETVSKDDLDRYADVLISALKVPEDD------LKSRPRNT 454  Thermoplasma acido...
15790563 383 -----DQDAADVAKRMLDYGVHPPTTKWPelVAEALMTEPTETESKRTLDDLADAFNAVAGDDDAA------LADAPSRT 451  Halobacterium sp. ...
15606927 383 NLTKYGVRASDVAKRILDYGFYAPTMYFPliVREALMIEPTETENPDTLKKFALILRKIVKEAKEKP-E--ILKKAPHRT 459  Aquifex aeolicus
16800455 390 RQKKLGVRTVDIAKRLLDHNFHPPTVYFPliVGEAIMIEPTETESKETLDSFIDTMLKIAKEAEENP-E--IVQEAPHST 466  Listeria innocua
15837986 915 APHTAVQVMASQwghAYSRELAAFPLGVLH-HAK 947  Xylella fastidiosa 9a5c
14521976 471 AVRRVDDVLASKk--PIITWKMYKELKEKGeVDY 502  Pyrococcus abyssi
14591728 471 AVRRVDDVLAAKk--PVITWKMYKELKEKGeIDY 502  Pyrococcus horikoshii
15927115 466 VIDRLDEATAARk--PILKFENLKQEK------- 490  Staphylococcus aureus subsp. aureus N315
15642987 455 PVRRVNEVLASKk--PVFRWR--------G---- 474  Thermotoga maritima
13541129 455 AVRRIDEVKAARd--LKLKW-------------- 472  Thermoplasma volcanium
16082341 455 AVSRIDEVKAARd--LKVRW-------------- 472  Thermoplasma acidophilum
15790563 452 TARRIDQTAAARn--PRLSWHDLD---------- 473  Halobacterium sp. NRC-1
15606927 460 PVRRIKEAEANRn--LILKFKDIKE--------- 482  Aquifex aeolicus
16800455 467 YVKRLDETRAARk--PVLRYQKEV---------- 488  Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap