Conserved Protein Domain Family
CcmA

?
COG1131: CcmA 
ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Statistics
?
PSSM-Id: 224054
View PSSM: COG1131
Aligned: 323 rows
Threshold Bit Score: 135.128
Threshold Setting Gi: 15674185
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17228983  340 AKIAISAQNLNRVFG-----------------------DFHAVVDLNLDIRYGDVYGLLGANGAGKTTAIKMLCGLLPI- 395  Nostoc sp. PCC 7120
19114907   50 MRNFTVEGAFNPKFQirsffaqllhpiniifrtgpkrdIIPLVKGFDGYLQPGSSLLVLGHEGSGGSTLLKALCGIVEEn 129  fission yeast
1351079   152 NILCLPLTIFKGIKAkrh------------------qkMRQIISNVNALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQf 213  baker's yeast
6093665   161 NIVPKLLTKGLRLLKpske-----------------edtFQILKPMDGCLNPGELLVVLGRPGSGCTTLLKSISSNSHGf 223  baker's yeast
731781     30 AVQNDEESASEFKNVgh-----------------------lEISDITFRANEGEVVLVLGNP---TSALFKGLFHGHKHl 83   baker's yeast
1730699    21 DILCLPWTIIKGIRErkn-----------------rnkMKIILKNVSLLAKSGEMVLVLGRPGAGCTSFLKSAAGETSQf 83   baker's yeast
464819    151 NIPYKILKSGLRKFQrske-----------------tntFQILKPMDGCLNPGELLVVLGRPGSGCTTLLKSISSNTHGf 213  baker's yeast
1709621   161 NMPIKYLKMSWRCISrrlfhrth-------gksedndsGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGf 233  baker's yeast
6093664   140 NIASIPAHLISKFTKksd------------------vpLRNIIQNCTGVVESGEMLFVVGRPGAGCSTFLKCLSGETSEl 201  baker's yeast
16331925  220 dnirldARNIVRTVQgnq------------------seeITLLNQISLPIEPGQLVALVGGSGAGKSTFMRTLLGIEPT- 280  Synechocystis sp....
17228983  396 --SSGEISLAGETGDLR--SAELRQRIGYMSQKFT-LYDDLTILENLQFYSGVYGIPp--------RQQREKISWVLSIS 462  Nostoc sp. PCC 7120
19114907  130 erLNGSLHYDGLDYKIA--HSQFKADLSYCGEGHS-KVATITVRRLLEFVCSCRLPAsk-----ydHPRSHYIRRICEII 201  fission yeast
1351079   214 -aGGVS-GEVAYDGIPQeeMMKRYKADVIYNGELDvHFPYLTVKQTLDFAIACKTPAlrvnnvskkEYIASRRDLYATIF 291  baker's yeast
6093665   224 -kIAKD-SIVSYNGLSSsdIRKHYRGEVVYNAESDiHLPHLTVYQTLFTVARMKTPQnrikgvdreAYANHVTEVAMATY 301  baker's yeast
731781     84 -kYSPE-GSIRFKDNEYkqFASKCPHQIIYNNEQDiHFPYLTVEQTIDFALSCKFHIpk------qERIE-MRDELLKEF 154  baker's yeast
1730699    84 -aGGVTTGHISYDGIPQkeMMQHYKPDVIYNGEQDvHFPHLTVKQTLDFAISCKMPAkrvnnvtkeEYITANREFYAKIF 162  baker's yeast
464819    214 -dLGAD-TKISYSGYSGddIKKHFRGEVVYNAEADvHLPHLTVFETLVTVARLKTPQnrikgvdreSYANHLAEVAMATY 291  baker's yeast
1709621   234 -kISPD-TIITYNGFSNkeIKNHYRGEVVYNAESDiHIPHLTVFQTLYTVARLKTPRnrikgvdrdTFAKHMTEVAMATY 311  baker's yeast
6093664   202 -vD-VQ-GEFSYDGLDQseMMSKYKGYVIYCPELDfHFPKITVKETIDFALKCKTPRvridkmtrkQYVDNIRDMWCTVF 278  baker's yeast
16331925  281 --TSGTVYLNGEDLRNn--FNLYRNQIGYVPQKDI-IHSSLTVEEALRYAAKLRLPq--------dADIDEIVEKTLGQI 347  Synechocystis sp....
17228983  463 GLEG--QE---HLLTRQLPGGWKQRVAFGASVIHEPEILFLDEPTSGVDVLARQQFWQLINDFARHG--TAILVTTHYMN 535  Nostoc sp. PCC 7120
19114907  202 RDAFdlGDfynHRILRVFNSGDQIKVDVAQTMCARPLIQCWDNNMRDFDSISVIDILSRIKVLSHKLgtTLVAIVSQASD 281  fission yeast
1351079   292 GLRHtyNTkvgNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLksTAFVTIYQASE 371  baker's yeast
6093665   302 GLSHtrDTkvgNDLVRGVSGGERKRVSIAEVAICGARFQCWDNATRGLDSATALEFIRALKTQADIGktAATVAIYQCSQ 381  baker's yeast
731781    155 GLSHvkKTyvgNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALEFLSITQKMAKATrsVNFVKISQASD 234  baker's yeast
1730699   163 GLTHtfDTkvgNDFISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIRTMTNLLgtTALVTVYQASE 242  baker's yeast
464819    292 GLSHtrNTkvgNDIVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRALKTQADISntSATVAIYQCSQ 371  baker's yeast
1709621   312 GLSHtaDTkvgNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITksAATVAIYQCSK 391  baker's yeast
6093664   279 GLRHtyATkvgNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIRTATNMVnnSAIVAIYQAGE 358  baker's yeast
16331925  348 EMQE--RR---HVLVKKLSGGQLKRVSIGVELLVDPKLFFLDEPTSGLDPGLDKKMMQLLRKLADQg--RTIVLVTHATG 420  Synechocystis sp....
17228983  536 EAEQ-CSRMCFMVAGRKVAEG-SASE--IKAAQPGQLFe--------LKIGELQGSYDRlr-----qFLEPWRVSIFgdr 598  Nostoc sp. PCC 7120
19114907  282 RIFHmFDMVTLMYEGEQIFYGpTSRLkpYFLDLGFIPAkhsttvefvTSLTYPEMRIINkkhqgfipSTPAEFRECWlrs 361  fission yeast
1351079   372 NIYEtFDKVTVLYSGKQIYFG-LIHE--AKPYFAKMGY---------LC--PPRQATAEflta--ltdPNGFHLIKPgye 435  baker's yeast
6093665   382 DAYDlFDKVCVLDDGYQLYFG-PAKD--AKKYFQDMGY---------YC--PPRQTTADflts--itsPTERIISKEfie 445  baker's yeast
731781    235 KIVSkFDKILMLGDSFQVFYG-TMEE--CLTHFHDTLQ---------IKKNPNDCIIEYltsilnfkFK-ETSNSIVgld 301  baker's yeast
1730699   243 NIYEtFDKVTVLYAGRQIFCG-KTTE--AKDYFENMGY---------LC--PPRQSTAEylta--itdPNGLHEIKPgfe 306  baker's yeast
464819    372 DAYDlFNKVCVLDDGYQIYYG-PADK--AKKYFEDMGY---------VC--PSRQTTADflts--vtsPSERTLNKDmlk 435  baker's yeast
1709621   392 DAYDlFDKVCVLYDGYQIFFG-PSKQ--AKKYFQRMGY---------VC--PERQTTADylts--itsPSERIKDKDmvk 455  baker's yeast
6093664   359 NIYElFDKTTVLYNGRQIYFG-PADK--AVGYFQRMGW---------VK--PNRMTSAEfltsvtvdFENRTLDIKPgye 424  baker's yeast
16331925  421 NINLcDRLVFLGQGGNLCYFG-TFSD--ACQFFnlhngdfadvyiqldnqsavikaaqrysrssyqhqyidqrlgvsnsa 497  Synechocystis sp....
17228983  599 lhv-----------------------vldhpTAELPQVRSYLQSANLSLT-DIQPMPFSLEDAFIGEVQR 644  Nostoc sp. PCC 7120
19114907  362 edyaklikfmdry--eenhsdihafkdakfdQTRLQKFLRWLNSNPCLIPyRLQVFATAKVTFFQYLHDY 429  fission yeast
1351079   436 nkvprtaeefety--wlnspefaqmkkdiaaYKEKVNTEKTKEVYDESMA-QEKSKYTRKKSYYTVSYWE 502  baker's yeast
6093665   446 kgtrvpqtpkdmaeywlqsesyknlikdidsTLEK-NTDEARNIIRDAHH-AKQAKRAPPSSPYVVNYGM 513  baker's yeast
731781    302 tpsvvseenqaln---innetdlhtlwiqspYYKHWK-AITSKTVQECTR--KDVNPDDISPIFSIPLKT 365  baker's yeast
1730699   307 yqvphtadefeky--wldspeyarlkgeiqkYKHEVNTEWTKKTYNESMA-QEKSKGTRKKSYYTVSYWE 373  baker's yeast
464819    436 kgihipqtpkemndywvkspnykelmkevdqRLLN-DDEASREAIKEAHI-AKQSKRARPSSPYTVSYMM 503  baker's yeast
1709621   456 hgimipqtayemnqywiqseeykqlqvqvnkHLDT-DSSQQREQIKNAHI-AKQSKRARPSSPYTVSFFL 523  baker's yeast
6093664   425 dkvpksssefeey--wlnsedyqellrtyddYQSRHPVNETRDRLDVAKK-QRLQQGQRENSQYVVNYWT 491  baker's yeast
16331925  498 vaaprpspprvsplrqtwilcqrywqimardpvnigisiatapigillidlaiatrepfilgseadpkla 567  Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap