1JSQ


Conserved Protein Domain Family
MdlB

?
COG1132: MdlB 
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms]
linked to 3D-structure
Statistics
?
PSSM-Id: 224055
View PSSM: COG1132
Aligned: 302 rows
Threshold Bit Score: 87.4842
Threshold Setting Gi: 18313248
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JSQ_A    10 WQTFRRLWPTIAp-FKaGLIVAGVALILNAASDTFMLSLLK----PLLDDGfg-------------ktDRSVLVWMPLVV 71  Escherichia coli
19552739  25 STPVKSAWALLWa-FPaATWLLVFGMLVSSMFGAVVSLVVG----RGSEWAfg-------------sgELMPVLVVSVAL 86  Corynebacterium glu...
15805136  22 SPSPARTFALARr-LFaYTPGLFAFNLLMWGMVHASPALLT----VAISGLfg--------------hLEEAERGVSTGI 82  Deinococcus radiodu...
16264605  25 AVVILGLASAALegAG-IGLIIPMLGIIAGDGQANGLSGIS----AYFQAIgeg----------------lgDGERLLVI 83  Sinorhizobium meliloti
17230114   1 -----------------------------MGLPALPGLIIR----EFFNSLt----------------gKAQFGLSPWAF 31  Nostoc sp. PCC 7120
17228079   1 MLTRRILLKFAKp-YPgLILLTIILGFSGALFNGISTALIVpvilRIVGQPvdlkgapg--llkaimtPFDNVPENYRIA 77  Nostoc sp. PCC 7120
20141347  15 WKENNLILREIKh-FRkIAILAVIFSFLAASFEGVSIGFLL----SFLQKLtspndpiqtgiswvdmiLAADAWPIPPIY 89  Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842   1 --MVLGLVGAALegFG-IGLIIPLLGIIMGHSDATGMAGFS----AVLQQVgsg----------------fsERDRLVVI 57  Mesorhizobium loti
16329205   2 PPIYQLLWQMIRy-AQkLYWLDTILWLFILGIPIVPGLLIR----QFFDTLt----------------sQTQIKESPWVW 60  Synechocystis sp. P...
1JSQ_A    72 IGLMI-----LRGITSYVSSYCISWVS-----GKVVMTMRRRLFGHMMGMP-----VSFFDKQS---TGTLLSRITYDSE 133 Escherichia coli
19552739  87 AVLLW-----VIYILEGSADALTDLAS-----ARVVHNLRLELSGKLVTTP-------RNSLTP----GEMLNTVDQDSV 145 Corynebacterium glu...
15805136  83 AAAWVslgwfAFVRASRFGIFYGAFRAwvelwYTLDALVRRNLLGYLLTAPg----SRRLPDTP----AEAVSRFRDDVE 154 Deinococcus radiodu...
16264605  84 AAAVL-----ALIVLKNILAFANTLLTtf-iyGKASHAIRSALSDQLLRIG-----YPFFMQQSp---gRLLNIISNESW 149 Sinorhizobium meliloti
17230114  32 IAGFV-----ALNLGHILVILIGRITKtq-hrFTMRSLLRRNLLERLLNNPhaqikAAHNDTEKtvsQGEVISYFRDDTE 105 Nostoc sp. PCC 7120
17228079  78 AMAGAi---iLTIALKNLATYTSTLSSss-ltRRLTADMREAGIDLLLNID-----IDYYAKTK---VGDLINRLGGEIG 145 Nostoc sp. PCC 7120
20141347  90 RISLLi---lLSTWMRATFNYFGGVYTes-aqLNLADRLHKQIFEQLQALR-----LSYFAQTR---SGELINTITTEIE 157 Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842  58 SAAIL-----GSIVLKNIFAFANTLLTtf-isGKASHSIRSALSEQLLRVG-----YPFFLRQSp---gRLLNIISNESW 123 Mesorhizobium loti
16329205  61 IGLFL-----AVGLGRMAAIFTGRITKtq-hrFLMSGLVRHNLFQGLLHRPgaelaSGAVDGQKv-sPGEMLSYFRDDAL 133 Synechocystis sp. P...
1JSQ_A   134 QVASSSSGA-LITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLK 212 Escherichia coli
19552739 146 QIGGLKQVLnFPIMMVG--YLLGSTISIAPISPLIAVLLVVGGVFTALASYFTATPLTKISAKRREAESKSVSLATDVAQ 223 Corynebacterium glu...
15805136 155 DVAGYTEVW-VDGAGf-LVYTLVAVTLMARVDPLITVLVCAPLLLMIVFVQRLSPTIRTYRRRMREATARVTDFIGETFG 232 Deinococcus radiodu...
16264605 150 RASDAIQTVlSSIVHG-SAAVILLAFLLLMS-WQMTLFVALGLVFVQLAHAALSaTLKGPSRHVTSFNSELAARMLHLVH 227 Sinorhizobium meliloti
17230114 106 HIEDNVAW--VSEIFGEGIFAVLSLVILLSVNVPMTLFVFLPLVGMVVIIQKTETRIKQYRKSSRQATQQVTGILGEIFS 183 Nostoc sp. PCC 7120
17228079 146 RAASYVGN--IIRLVIVSVTISVFVCLLLSISWQLTIMATILLSLVTLVNQFAISRSRQFGKILSEMSKAYSIAVLETLN 223 Nostoc sp. PCC 7120
20141347 158 RIKQGFSG--LAFVLTRIMTVCVYFVVMFSISWQLSIISVLIFLLLAVGLSTLNKRVRETSFGISHANAQFTAVAVEFIN 235 Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842 124 RASDAIQIMlSAIISA-SAAAILLAFLLLLS-WRMTLLVTLGLALVQIAHAILSaNLKEPSRSVASRNSHLASQMLHLVH 201 Mesorhizobium loti
16329205 134 QIEDTVVG--TNEIFAAGVFAVVSVALLLSVNREMTLLVFVPLCLITALAHHAEHRLKRYRRASRHGTQQVTGFIGEMFT 211 Synechocystis sp. P...
1JSQ_A   213 GHKEVLIFGGQEVE-TKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDS----LTAGTITVV 287 Escherichia coli
19552739 224 GSRVVKGLGAVSQT-EERFGAAADEALAIMLKEVRLQSLLTFVRQLVPAVFSVGLLAYASLLAFDGD----ITGGEMISV 298 Corynebacterium glu...
15805136 233 AVSAVKLAGREEQM-VAHLRRLGETRQQAALRDVLLTELIRGVNTNMVNLAVGLVLLLGANRVRGEA----LSVQDFVLF 307 Deinococcus radiodu...
16264605 228 AGRLIRVFGQETREkNAFDSASDAVRRAG----FALQSRQGALPPLTEVLHSALFLAVVVS-----AwsigVSFPVIVAF 298 Sinorhizobium meliloti
17230114 184 SVQAIKVAGAEQDV-LSYFRTLNDNRRETMVKDTLLKAILNSLFQNMVNFGTGLILVMASFLMQSGSn--qLTVGDFALF 260 Nostoc sp. PCC 7120
17228079 224 GIRLVKTTANERKE-FNRIKRLIRERESADFKAQMNSNAITPLSEFLGVTSLLIIVLLSKTFFADQIs---TLSAVLLTY 299 Nostoc sp. PCC 7120
20141347 236 GIRTIQAFGTQEFE-RQRFYKASTNQLNAAIKVVLAWTLVKPIAEGIATTVLISLIVISFATFT-------LPVASLLTF 307 Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842 202 AGRLIRIFGQEGREkAIFDTASDGVRRAS----FVLQVRQGALPPLTEVLHAMLFLAVVIG-----AwlaqVSFPLIIAF 272 Mesorhizobium loti
16329205 212 AVQAIKVAGAETEM-LEELRKRGDLRRRLMVRDQVFNAILNSGFENTVSIGTGLILLLAAQSLGPQGn---FTVGDFTLF 287 Synechocystis sp. P...
1JSQ_A   288 FSSMIALMRPLKSLTNVNAQFQ-RGMAACQTLFTILDS-------------EQ--------EKDE-GKrv---------- 334 Escherichia coli
19552739 299 TLLVPPSLTVLGVSLGMMTEIWaRGQASTKRVQNLVT------------------------------------------- 335 Corynebacterium glu...
15805136 308 IGLLPRLTGSMGFFGDAIARHR-RTGVSFERMNRLLVDap----------gDEt-------VRHQpVYlrae-----ppa 364 Deinococcus radiodu...
16264605 299 VVLLYRLQPHMRALQMSWSQIQ-GWSGSLEEVRWLLDS-------------SDk-------PKAPqGNapv--------- 348 Sinorhizobium meliloti
17230114 261 VYNLSFVTGFFASVGGFMALYK-QTEVAFERMTTLISGas----------tETlvapnqlyLQDLgKSrknlprleqpkn 329 Nostoc sp. PCC 7120
17228079 300 LLILLRLLPLVSQLNSLRSSFA-SMNASVDSVTELLRLd------------DKp------fLINGkIAy----------- 349 Nostoc sp. PCC 7120
20141347 308 FFVLVRVIPNIQDINGTVAFLS-TLQGSSENIKNILQTn-----------nKPy-------LKNGkLH------------ 356 Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842 273 VILLYRLQPHMRALQGSWSQLQ-GLSGSLEEVTWMLDP-------------ADk-------PRPPqGDgpf--------- 322 Mesorhizobium loti
16329205 288 VYYLSFVSDFLAFFGVFLASVK-QSEVSFERMAVLVNGgecpspstvnptsFPltyphhlyLKPIlGSqpalpp--lstp 364 Synechocystis sp. P...
1JSQ_A   335 iERAT-GD----VEFRNVTFTYPg--rDVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDL 407 Escherichia coli
19552739 336 -------------ELDKAAAEPRp--------QPATFEFEEGITVW--DPS---TPEARDVIDRELEALQ--VR------ 381 Corynebacterium glu...
15805136 365 lPAREaAEplreLRVEHLSAHHP----DGGGVHDVSFTLRRGEFVVVTGRIGSGKSTLLRAVLGLLPTDGGRIVWNGEEV 440 Deinococcus radiodu...
16264605 349 --dgLhQG----MTFDRVTFRYPgsevRPLVLHSASFEIRSGRSTAIIGRSGAGKTTIVNLLCRFVEPDEGRILVdgVPL 422 Sinorhizobium meliloti
17230114 330 nASHQlQS----LKLTNLTYIYPg---TTQGIVDINLQIQRGSLTVITGRIGAGKTTLLRVLLGLLPKQAGEIYWNNHLV 402 Nostoc sp. PCC 7120
17228079 350 -nGLKtG-----ITFKSVSFTYPg--hDKQVLKDVTLKLPRGTTLALVGGSGAGKSTLADLLPRFYDPTGGCIILDDTDL 421 Nostoc sp. PCC 7120
20141347 357 -FQGLkRS----IDLVSVDFGYTa---DNLVLNNITLTIERGKTTALVGASGAGKTTLADLIPRFYDPTEGQILVDGLDV 428 Nostoc sp. PCC 7120
17228788     --------------------------------------------------------------------------------     Nostoc sp. PCC 7120
13471842 323 --hgLrRG----IKFDDVTFTYSgtdqREVVLHAATFEINSGRSTALIGRSGAGKTTIVNLLCRFVEPDTGRILVdgSPL 396 Mesorhizobium loti
16329205 365 aQTDPlQE----LRVEGLVYHYPg---SDNGIADISFSLQRGSLTVITGRVGVGKTTLIRTLLGLLPKQSGKIIWNGLEI 437 Synechocystis sp. P...
1JSQ_A   408 REYTLASLRNQVA-LVSQNVHLFN-DTVANNIAYARTEqYSR-EQIEEAARMA--YAMDFINKMDNGLDTVIGENGVLLS 482 Escherichia coli
19552739 382 EDVIVAPHRVSVFeGVLKDN-LNPmGTIAPEMLRAALH-AAScEDILSRLGADlnMPGEF--ELP---DTLIGEAGLNLS 454 Corynebacterium glu...
15805136 441 TDPASFLVPPRSA-YTAQLPNLFS-DSLRDNVLSG----ADA-DRLPLAVRLA--RLDADLAQLPQGDGTPVGARGVKLS 511 Deinococcus radiodu...
16264605 423 GQINPVQWRRQIA-VASQDLELVD-GTILENITYGQS--ATP-AEAERAAKLA--EAHGFIEQLPQGYETLVGYRGASLS 495 Sinorhizobium meliloti
17230114 403 ADPANFFVPPRSA-YTPQIPQLFS-YSLRENILLGLSKd---dADIETALKMA--VFEQDLAAMNEKLETLVGTKGVRLS 475 Nostoc sp. PCC 7120
17228079 422 REFDITSIRKCMG-IVSQDTFLFN-NSVRNNIAYGKQE-ATE-EEVVAAAKRA--NAYEFISKLPQQFDTMIGDRGVMLS 495 Nostoc sp. PCC 7120
20141347 429 QYFEINSLRRKMA-VVSQDTFIFN-TSIRDNIAYGTSG-ASE-AEIREVARLA--NALQFIEEMPEGFDTKLGDRGVRLS 502 Nostoc sp. PCC 7120
17228788   1 ------------------------------------------------------------------------------MW 2   Nostoc sp. PCC 7120
13471842 397 DRIDANQWRRHIA-LASQELELVD-GTIFENISYGQDA-ATL-ADAERAARLA--EAHEFIERLPQGYETLVGYRGVNLS 470 Mesorhizobium loti
16329205 438 AEPATFFVPPRAA-YTPQIPQLFS-TSLRENLLLGLADdvsP-EQLNQAIATA--VFEQDLALMPKGLDTQVGTRGVRLS 512 Synechocystis sp. P...
1JSQ_A   483 GGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALD--ELQKN--R---TSLVIAHRLSTIEKADEIVVVEDGV 555 Escherichia coli
19552739 455 GGQRQRIALARFLAVDPEVLILDEPTTGLDAVT-------LD---------E-------VAHRVEKLRRGRKTVVITSNP 511 Corynebacterium glu...
15805136 512 GGQVQRTAVARMLAQQADLLVFDDVSSALDARTEAELWDGLFs-ELG----A---TCLVVSHRRAALTRAHRILVMEGGR 583 Deinococcus radiodu...
16264605 496 AGQRQRIALARALVRDPAILILDEATNAVDGLSEAAIVETLR--SRAGR--R---TTIVISHHRSTISFCDDVVVLGSGR 568 Sinorhizobium meliloti
17230114 476 GGQMQRVAAARMFVRQPELLIFDDLSSALDVETELALWSRIFanTTEEN--PwtpTCLVVSHRRSVLRRADQIIVMKAGR 553 Nostoc sp. PCC 7120
17228079 496 GGQRQRLAIARALLQNPDILILDEATSALDTVSERLVQGALE--ELSRD--R---TTLVIAHRLSTVRKADQIAVLEQGK 568 Nostoc sp. PCC 7120
20141347 503 GGQRQRIAIARALLRDPEILILDEATSALDSVSERLIQESIE--KLSVG--R---TVIAIAHRLSTIAKADKVVVMEQGR 575 Nostoc sp. PCC 7120
17228788   3 GKQRQRIAIARGGFKNLQVLILDKATSALDNKTEAAIERSLV--LTVDQ------------------------------- 49  Nostoc sp. PCC 7120
13471842 471 AGQRQRIALARALVRDPDLLILDEATNAVDGLSEAAIVETLK--SRAGR--R---TTIVISHHHSTISFCDDVVILSRGR 543 Mesorhizobium loti
16329205 513 GGQKQRVAAARMLVRQPELLVFDDLSSALDLETEQKLWRRLFstGHQRHsaVytpTCLVVSHRPSVIEQADTIVLLEAGR 592 Synechocystis sp. P...
1JSQ_A   556 IVERGTHNDLLEH-RGVYAQLHKMQFGQ 582 Escherichia coli
19552739 512 -TWHGVAKQMQSD----FSEGVK----- 529 Corynebacterium glutamicum ATCC 13032
15805136 584 VTAEGTLAELLET-SAEMRALWAEEE-- 608 Deinococcus radiodurans
16264605 569 VKGQAALADVASL-S--MDQLYEHETGM 593 Sinorhizobium meliloti
17230114 554 VVAQGKFEDILADeQADWIF-------- 573 Nostoc sp. PCC 7120
17228079 569 VVEVGTHEELLQK-GGYYSRLYGMQFSN 595 Nostoc sp. PCC 7120
20141347 576 IVEQGNYQELLEQ-RGKLWKYHQMQHES 602 Nostoc sp. PCC 7120
17228788     ----------------------------     Nostoc sp. PCC 7120
13471842 544 VKKQAPFGALASL-S--MDELYQHEPQD 568 Mesorhizobium loti
16329205 593 IVFSGTPAQFNREmMGKNIVF------- 613 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap