Conserved Protein Domain Family
Smc

?
COG1196: Smc 
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]
Statistics
?
PSSM-Id: 224117
View PSSM: COG1196
Aligned: 60 rows
Threshold Bit Score: 271.973
Threshold Setting Gi: 15594391
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6323115   154 LFINELVLENFKSYAGk-QVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR--ANKMRQDRLSDLIHKSEAFpSLQSC 230  baker's yeast
19074461    5 KFRKTIVSVELIKFMChdHLLISLRKPLTIVSGCNGSGKSAIMVAIGLVFGQRa-SHLERGSSFKDLIKSKESN------ 77   Encephalitozoon c...
19173313    1 MHIKQIRLKNFRSFRD--EVVVPLSEHTNIIVGRNGSGKSSIVSAVHFVLCGEkhSCESRTGLIHEGSRAMEEE------ 72   Encephalitozoon c...
19075000    7 GNIVSMELENFQTFKK---MSLGFCSSFNFIAGPNGSGKSSIANAMVLVFGGTp-KVIGRGKTVGEYVRFGERE------ 76   Encephalitozoon c...
19114172    1 MYITKIVIQGFKSYKDy-TVIEPLSPHHNVIVGRNGSGKSNFFAAIRFVLSDA--YTHLSREERQALLHEGPGA--TVMS 75   fission yeast
8489009     8 YALGSIVRIKLVNFVTydYCELFPGPYLNLIIGPNGTGKSTIVSAICIGLGWPp-KLLGRAKEAREFIKYGKNT------ 80   fission yeast
1709997     1 -MTTELTNVSLEEAITe-KTSENRRKRDSDVLQTEEVDLSNVKRIRASRNQDNrpERQSRLQRSSSLIEQVRGNeDGEND 78   fission yeast
730753      1 MKVEELIIDGFKSYATr-TVITDWDPQFNAITGLNGSGKSNILDAICFVLGIAs-MSTVRASSLQDLIYKRGQA---GVT 75   baker's yeast
1352989     1 MYIKRVIIKGFKTYRNe-TIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDD--YSNLKREERQGLIHQGSGG--SVMS 75   baker's yeast
6324539    37 FQPGSIIKIRLQDFVTytLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKp-EYIGRSKKVEDFIKNGQDV------ 109  baker's yeast
6323115   231 svAVHFQYVIDESS--GTSRIDEEk--pGLIITRKAFK-NNSSKYYINEKESSYT-------EVTKLLKNEGIDLDHKr- 297  baker's yeast
19074461   78 ---AAVRIVLENHR--GFRKEFFGe---TIIIEKRIGMkSAT-TSIMNGERRVWStr---reDLETVLEFFALRFENPl- 144  Encephalitozoon c...
19173313   73 ---GSVEIVFCDGL--QEAGSGRE-----FSVKRTVSVkKDE--YMVDNRIVSRD-------ELVGLLQTNGFAVGSPy- 132  Encephalitozoon c...
19075000   77 ---AKIEVVVWIKGk-------------ETRLCRCISK-DSQSKYFVDGKSYKKT-------EYEEFVGRFKKNIGNLc- 131  Encephalitozoon c...
19114172   76 ---AYVEVTFANAD--NRFPTGKS----E-VVLRRTIGlKKD-EYSLDKKTVSKT-------EVINLLESAGFSRSNPy- 136  fission yeast
8489009    81 ---ATIEIEMKYRD---------De---TVTITRQISQ-DKSSSFSINREACATS-------SITSLMDTFNVQLNNLc- 136  fission yeast
1709997    79 v-LNQTRETNSNFD--NRVGVIECihlvNFMCHDSLKInFGPRINFVIGHNGSGKsailtglTICLGAKASNTNRAPNmk 155  fission yeast
730753     76 --KASVTIVFDNTDk-SNSPIGFTns-pQISVTRQVVL-GGTSKYLINGHRAPQQ-------SVLQLFQSVQLNINNPn- 142  baker's yeast
1352989    76 ---ASVEIVFHDPDhsMILPSGVLsrgdDEVTIRRTVGlKKD-DYQLNDRNVTKG-------DIVRMLETAGFSMNNPy- 143  baker's yeast
6324539   110 ---SKIEITLKNSPn-VTDIEYIDardeTIKITRIITRsKRRSDYLINDYQVSES-------VVKTLVAQLNIQLDNLc- 177  baker's yeast
6323115   298 FLILQGEVENIAQMKPKAEKEsddglleYLEDIIGTANYKPLIEERMGQIENLNEVCLE--KENRFEIVDREKNSLESGK 375  baker's yeast
19074461  145 NFLTQEQAKRFLSTMDPEMLYe------LFMQGTEIAEICRLNSESMSNVEAMRRRISL--VAEELDGIEKRIKDEEGVL 216  Encephalitozoon c...
19173313  133 FVVLQEEVSELAVVDDRRRYE-------LMKNVAGVSGYEKDRESSMSILEETKQSEKK--IELLLERVEDKLRGLESDK 203  Encephalitozoon c...
19075000  132 QFLPQEKVSEFTRLPPENLLVev----lLAVGEEEVLEYLKELEDLEAERDRLVETLES--CTRKKECIERAIEVLGRDV 205  Encephalitozoon c...
19114172  137 YIVPQGRVTSLTNAKDSERLE-------LLKEVAGTQIYENRRAESNKIMDETIQKSEK--IDELLQYIEERLRELEEEK 207  fission yeast
8489009   137 HFLPQDRVAEFAQLDPYSRLMet----eRAIDHEGLLPAHEKLIDLRKREREILQNKNQ--GQSTLNSLKDRQQALEKEV 210  fission yeast
1709997   156 SLVKQGKNYARISVTISNRGFe-----aYQPEIYGKSITIERTIRREGSSEYRLRSFNGtvISTKRDELDNICDHMGLQI 230  fission yeast
730753    143 FLIMQGKITKVLNMKPSEILS-------LIEEAAGTKMFEDRREKAERTMSKKETKLQEn-RTLLTEEIEPKLEKLRNEK 214  baker's yeast
1352989   144 NIVPQGKIVALTNAKDKERLQ-------LLEDVVGAKSFEVKLKASLKKMEETEQKKIQ--INKEMGELNSKLSEMEQER 214  baker's yeast
6324539   178 QFLSQERVEEFARLKSVKLLVe-----tIRSIDASLLDVLDELRELQGNEQSLQKDLDF--KKAKIVHLRQESDKLRKSV 250  baker's yeast
6323115   376 ETALEFLEKEKQLTLLRSKLFQFKLLQSNS--KLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCs 453  baker's yeast
19074461  217 DAINNAKDMEKTILCLEDEMVWARVNEKRM--QMEKCFERFRDKQEEMDKYSERLEELSQAIGEARKRMNSIEAEEGERk 294  Encephalitozoon c...
19173313  204 KEAELCEELEKEKRRLEYGYIEREVREING--EIFRIEELVSSDPEEVSEESGDFGCEIGEIENKLTNLINRRKELHVNe 281  Encephalitozoon c...
19075000  206 EKVCEEGRKRERIRVMREKQEWMHYKHHTD--EYVAIKKAVGLLRKQIEVKNKEVLKIEDKIIELKSSETCKEMDGLWS- 282  Encephalitozoon c...
19114172  208 NDLAVYHKKDNERRCLEYAIYSREHDEINS--VLDALEQDRIAALERNDDDSGAFIQREERIERIKAEITELNHSLELLr 285  fission yeast
8489009   211 NIFKEREKIKSYIEMLGLAKMLVIYREKTN--VFNQLRADKKKLKKDLKDLVEEFQPILDKGEELRSDLKLKDDTFNDY- 287  fission yeast
1709997   231 DNPMNILTQDTARQFLGNSSPKEKYQLFMKgiQLKQLEENYSLIEQSLINTKNVLGNKKTGVSYLAKKEEEYKLLWEQSr 310  fission yeast
730753    215 RMFLEFQSTQTDLEKTERIVVSYEYYNIKH--KHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKEl 292  baker's yeast
1352989   215 KELEKYNELERNRKIYQFTLYDRELNEVIN--QMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKn 292  baker's yeast
6324539   251 ESLRDFQNKKGEIELHSQLLPYVKVKDHKE--KLNIYKEEYERAKANLRAILKDKKPFANTKKTLENQVEELTEKCSLK- 327  baker's yeast
6323115   454 SKEKTLVL--------ERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELR----GQQTEHETEIKD 521  baker's yeast
19074461  295 RNGDR--R---------SEEIDGMISRLRMRRREICNDSEELKEARDFKKKIVSDFEKQDGTV-------KSLLPQLEDK 356  Encephalitozoon c...
19173313  282 ----------------KYKDKEPEIKDEMKKIEKKRSDLQDTQKVERERLVKLRDEERENFVR--------SGYIKYLTG 337  Encephalitozoon c...
19075000  283 ----------------ILREHDTNLVKVVEELRDIHQETEMLGVDEESLKNKREKRMTNLER-------LKKEILDLQDE 339  Encephalitozoon c...
19114172  286 VEKQQNDEdytn-imkSKVALELQSSQLSRQIEFSKKDESSKLNILSELESKISEKENELSEILpkynAIVSEADDLNKR 364  fission yeast
8489009   288 ----------------SSASMELNTSNLRARASFSNFMENEKKLYEKVNTNRTLLRNANLTLN---------EAQQSVKS 342  fission yeast
1709997   311 ETENLHNLl-------EQKKGEMVWAQVVEVEKELLLAEKEFQHAEVKLSEAKENLESIVTNQs----DIDGKISSKEEV 379  fission yeast
730753    293 HKEGTISKle-----nKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEK-------KSAYANTEKD 360  baker's yeast
1352989   293 ATDLQQAKlreseisqKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILp----RYQELTKEEAM 368  baker's yeast
6324539   328 TDEFLKAKe-------KINEIFEKLNTIRDEVIKKKNQNEYYRGRTKKLQATIISTKEDFLRS-------QEILAQTHLP 393  baker's yeast
6323115   522 LTQLLEKERSILD--DIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEK 599  baker's yeast
19074461  357 HKRIASEVETLQG---VLERLGDESRECREKAKVEEEAASEREGRILHLRKQIEFYSK---------------------- 411  Encephalitozoon c...
19173313  338 FLETLGSRNIKAG------EIETAKSILKEKLEKLRALNSSGRHEAENAEETRD-------------------------- 385  Encephalitozoon c...
19075000  340 VSKVEIPPQPRGP-------DEARIEVLEEKMSGLMRARGKIQHESSELKRLVDDLSLKRKKFHEMDEMR---------- 402  Encephalitozoon c...
19114172  365 IMLLKNQKQSLLD----KQSRTSQFTTKKERDEWIRNQLLQINRNINSTKENSDYLKTEYDEMENELKAKLSRKKEIEIS 440  fission yeast
8489009   343 LTERQGPRPSDNG----------V-QDLQEKMQEVNAEKLQHENEKLESSHELGSIRT---------------------- 389  fission yeast
1709997   380 IGRAKGETDTTKS---KFEDIVKTFDGYRSEMNDVDIQKRDIQNSINAAKSCLDVYREQLNTERARENNLGGSQIEKRAN 456  fission yeast
730753    361 YKMVQEQLSKQRD---LYKRKEELVSTLTTGISSTGAADGGYNAQLAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPK 437  baker's yeast
1352989   369 YKLQLASLQQKQRdlILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNELESQLQMDRTSLRKQYSAIDEEIEELIDS 448  baker's yeast
6324539   394 EKSVFEDIDIKRK------EIINKEGEIRDLISEIDAKANAINHEMRSIQRQAESKTKSLTTTDKIG------------- 454  baker's yeast
6323115   600 ILA--KKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKaq---nkSKVLT 674  baker's yeast
19074461  412 ---------------------------NDQNSFFGPSFPAAMDEISRTKFN----------------------------- 435  Encephalitozoon c...
19173313  386 -----------------------LEELIERRKHLWREEKRLRLLDASIEEMVKSQENRLMAMGN---------------I 427  Encephalitozoon c...
19075000  403 -----------------------LQMLRKYHPDTHRAVCWLRENKHRFKDEIVEPPFVQLR-----------------VK 442  Encephalitozoon c...
19114172  441 LES--QGDRMSQLLANITSINERKENLTDKRKSLWREEAKLKSSIENVKDDLSRSEKALGTTMDRNTS--------NGIR 510  fission yeast
8489009   390 -------------------LKAQK--LID-LDNIKRELSYYNDATKRKLDFMSSAPGWEDAYQT---------------Y 432  fission yeast
1709997   457 ESNn-LQREIADLSEQIVELESKRNDLHSALLEMGGNLTSLLTKKDSIANKISDQSEHLKVLEDVQRDkvsafgkNMPQL 535  fission yeast
730753    438 LKEa-TK-DNELNVKHVKQCQETCDKLRARLVEYGFDPSRIKDLKQREDKLKSHYYQTCKNSEYLKRRvtn--leFNYTK 513  baker's yeast
1352989   449 INGpdTKGQLEDFDSELIHLKQKLSESLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLAn-----gIINVK 523  baker's yeast
6324539   455 --------------------------ILNQDQDLKEVRDAVLMVREHPEMKDKILEP----------------------- 485  baker's yeast
6323115   675 ALSRLQKSGrINGFHGRLGDLGVIDD-SFDVAISTACP-RLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNL 752  baker's yeast
19074461  436 -----------GEVVGPIAFEVKVKEeRWSKAISIVLNnSLSTFIVTNRVDKDALLRIFRRHKVDFPISTLSSRVPEVIK 504  Encephalitozoon c...
19173313  428 GLDVHSQIKcEEGVLGYVYDLISVPN-ELVNAFEAVVGnALFNIVVSNEEVASKVLKKMKD-LRFRITLMPLSRIKYRES 505  Encephalitozoon c...
19075000  443 DAKYALEVEnFLGFQSLSPFI--CKSsEDFETFVRIMKdEKKWMINAIEAIKMDGKMGIKEEAISREMLKELGFEGVLSN 520  Encephalitozoon c...
19114172  511 AVKDIAERLkLEGYYGPLCELFKVDN-RFKVAVEATAGnSLFHIVVDNDETATQILDVIYKENAGRVTFMPLNKLRPKAV 589  fission yeast
8489009   433 QLLKEYESAfEAPAYGPIYMNLKCKEkGFAALIEGFFRtDTFRTFIMS---NYNDYLKLMDLITSKTKYTPTIREFSSER 509  fission yeast
1709997   536 LKLITRETRfQHPPKGPMGKYMTVKEqKWHLIIERILGnVINGFIVRSHHDQLILKELMRQSNCHATVVVGKYDPFDYSS 615  fission yeast
730753    514 PYPNFEASF-VHGVVGQLFQIDNDNI-RYATALQTCAGgRLFNVVVQD--SQTATQLLERGRLRKRVTIIPLDKIYTRPI 589  baker's yeast
1352989   524 EITEKLKIS-PESVFGTLGELIKVND-KYKTCAEVIGGnSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSD 601  baker's yeast
6324539   486 PIMTVSAINa------QFAAYLAQCV-DYNTSKALTVVdSDSYKLFANPILDKFKVNLRELSSADTTPPVPAETVRDLGF 558  baker's yeast
6323115   753 QPISTp-----EN-VPRLFDLVKPKNP-KFSNAFYSVLRDTLVAQNLKQANNVAYGK-KRFRVVTVDGKLIDISGTMSGG 824  baker's yeast
19074461  505 YKAN---------------PRYTSVLD-ALEVKNPFVMNYLIITTSIEQTILVESRK-EAYEIIRSRPAFVECAYTRNGD 567  Encephalitozoon c...
19173313  506 EEVKD-------PdVISLTSQLRCGQQ--YKALLRCVVKDFYLCSDLKQALYSSKKY--EINTVTLSGEIVTRDGPISGG 574  Encephalitozoon c...
19075000  521 --------------------FIECRDEvMNYLVVAGHFDSIPVSKGSVDESLVFRKT--NIKRMAAGGRYIEIKKSKYGS 578  Encephalitozoon c...
19114172  590 TYPD-------ASdALP-LIQYLEFDP-KFDAAIKQVFSKTIVCPSIETASQYARSH--QLNGITLSGDRSDKKGALTAG 658  fission yeast
8489009   510 KK------------------KIEDFEPpCSREKLQSFGFDGYVIDFLEGPEVVLVALcHMLKIHQIPIAKRELPPASVNA 571  fission yeast
1709997   616 GEPDs---------QYPTVLKIIKFDD---DEVLHTLINHLGIEKMLLIEDRREAEAyMKRGIANVTQCYALDPRNRGYG 683  fission yeast
730753    590 SSQVLdlakkiAPgKVELAINLIRFDE-SITKAMEFIFGNSLICEDPETAKKITFHPkIRARSITLQGDVYDPEGTLSGG 668  baker's yeast
1352989   602 VKFPsn---ttTQiQFTPLIKKIKYEP-RFEKAVKHVFGKTIVVKDLGQGLKLAKKH--KLNAITLDGDRADKRGVLTGG 675  baker's yeast
6324539   559 EG---------------YLSDFITGDK----R-VMKMLCQTSKIHTIPVSRRELTPAqIKKLITPRPNGKILFKRIIHGN 618  baker's yeast
6323115   825 gnhvakGLMKLGTnqsdkVDDYTpEEVdKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLA 904  baker's yeast
19074461  568 -----------------------------KIRLVGGSMSDFVTRGVDRFYFENAHEKLERCRAEMKRLAEERVER----- 613  Encephalitozoon c...
19173313  575 ------------------------------YEKRNAVFQEYKKISREARKVKGEISRVQHELGKIGKEIEEAKMS----- 619  Encephalitozoon c...
19075000  579 -------------------------------EHVIIYNPLKSRNLFSQNLSLQELGEIEDDLAKKNSTRRENEEK----- 622  Encephalitozoon c...
19114172  659 ------YRDYRNS------RLDAiKNVkTYQIKFSDLQESLEKCRSEIESFDQKITACLDDLQKAQLSLKQFERDHIPLK 726  fission yeast
8489009   572 -----------------------------LNNFRLANGDPVLKTYLAGSSIHLVFRSAYGDREITRRTDPLPSRSIYFSE 622  fission yeast
1709997   684 ------------------------------FRIVSTQRSSGISKVTPWNRPPRIGFSSSTSIEAEKKILDDLKKQYNFAS 733  fission yeast
730753    669 ------SRNTSES-----LLVDIqKYN-QIQKQIETIQADLNHVTEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLD 736  baker's yeast
1352989   676 y----lDQHKRTR-------LESlKNLnESRSQHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVYR 744  baker's yeast
6324539   619 --------------------------RlVDIKQSAYGSKQVFPTDVSIKQTNFYQGSIMSNEQKIRIENEIINLKNEYND 672  baker's yeast
6323115   905 SELTlAEQQVKEAEMAYVKAVSDKAQLnvvmknlerLRGEYNDLQSETKTKKEKIKGLQDEImkiggIKLQMQNSKVESV 984  baker's yeast
19074461  614 ------------RWERRLKEIKN-----------------------EMDKVSEDIESRNRMQ-----KALRVEMDHER-- 651  Encephalitozoon c...
19173313  620 --------REKGSDGSRYN---ES-------------------LKSVVLFLQEKIRILEEAS------KGNLDINKISVK 663  Encephalitozoon c...
19075000  623 ----------LKKVLKDCEVVDKELQE---------------LYRERSLHNSQVMDIK----------RREARIQILKGS 667  Encephalitozoon c...
19114172  727 DELV-TITGETTDLQESMHHKSRMLEL---------VVLELHTLEQQANDLKSELSSEMDELd----PKDVEALKSLSGQ 792  fission yeast
8489009   623 NVEMdLVKRKEEQLNAQLSQLENLQNE-------------ERKLQEKVNEHESLLSRTNDILs----TLRKERDEKLIPI 685  fission yeast
1709997   734 NQLN-EAKIEQAKFKRDEQLLVEKIEG----------------IKKRILLKRREVNSLESQEl----SVLDTEKIQTLER 792  fission yeast
730753    737 ANPSsQIIARNEEILRDIGECENEIKT---------KQMSLKKCQEEVSTIEKDMKEYDSDKg----SKLNELKKELKLL 803  baker's yeast
1352989   745 TSLN-TKKNEKLILEESLNAIILKLEK---------LNTNRTFAQEKLNTFENDLLQEFDSEl---sKEEKERLESLTKE 811  baker's yeast
6324539   673 RKST--LDALSNQKSGYRHELSELASK-----------------NDDINREAHQLNEIRKKY-----TMRKSTIETLREK 728  baker's yeast
6323115   985 CQKLD-ILVAKLKKVKSASKksgGDVVKFQKLLQNSERDV-ELSSDELKVIEEQLK-HTKLALAENDTNMNETLNLKVEL 1061 baker's yeast
19074461  652 -------HIHDTQMEIMKND----------------------DLYEEIRSLTHQIS-LLEKKQSEISEEIEVLEREKKEI 701  Encephalitozoon c...
19173313  664 LRRLR-EEEKDLRLKSIWTG-------------------------NEIRKVEIRVG-EAEIGIKKLNDSSRRLESELEKS 716  Encephalitozoon c...
19075000  668 MDRKK-LELEMLEDTKDLDE-----------------------EERRIYEARRKLEdTWKDKCDELDRHLS--DSRYFDA 721  Encephalitozoon c...
19114172  793 IENLS-HEFDAIIKERAHIE---ARKTALEYELNTNLYLRrNPLKAEIGS-DNRID---ESELNSVKRSLLKYENKLQII 864  fission yeast
8489009   686 HEWQQlQERIEHQTLLLRQR---------------EKVP--EQFAAEIEKNEDIRK-ENFEALMNSVLKVKENSIKATNN 747  fission yeast
1709997   793 RISETeKELESYAGQLQDAK-------------------------NEEHRIRDNQR-PVIEEIRIYREKIQTETQRLSSL 846  fission yeast
730753    804 AKELE-EQESESERKYDLFQnleLETEQLSSELDSNKTLL-HNHLKSIESLKLENS-DLEGKIRGVEDDLVTVQTELNEE 880  baker's yeast
1352989   812 ISAAH-NKLNITSDALEGIT---TTIDSLNAELESKLIPQeNDLESKMSEVGDAFIfGLQDELKELQLEKESVEKQHENA 887  baker's yeast
6324539   729 LDQLKrEARKDVSQKIKDID-------------------------DQIQQLLLKQR-HLLSKMASSMKSLKNCQKELIST 782  baker's yeast
6323115  1062 KEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELsirdvthtlgmldDNKMDSVKEDV 1141 baker's yeast
19074461  702 R---EYKGAGTGRLRQEISRNTAEASEVRRRIDMWRTDILKLKEEHQKQVELYNS---------------EKSLALESGK 763  Encephalitozoon c...
19173313  717 KMYGEAMEIEAKILELKDKKRAAREMMFNEENAGLFAKPKKINIEMEKLVRRKHMLi------------nKRSELCERIG 784  Encephalitozoon c...
19075000  722 FCNAVRLFREVMNVNKNIEFLEESKKVMEETIRKLDEEAAEKKKEGSILKRKIEE---------------GRMRLEKIEK 786  Encephalitozoon c...
19114172  865 KSSSSGLEEQMQRINSEISDKRNELESLEELQHEVATRIEQDAKINERNAAKRSLL-------------LARKKECNEKI 931  fission yeast
8489009   748 FEKMLGSRLNVIEAKYKLEKHEMDANQVNARLTEVQDRLKDITDKLASAREDAMSLy------------gSVVDSLQTQS 815  fission yeast
1709997   847 QTELSRLRDEKRNSEVDIERHRQTVESCTNILREKEAKKVQCAQVVADYTAKAN----------------TRCERVPVQL 910  fission yeast
730753    881 KKRLMDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDL-------------RQKHEFLEDFD 947  baker's yeast
1352989   888 VLELGTVQREIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTL-------------VTRREELQQRI 954  baker's yeast
6324539   783 QILQFEAQNMDVSMNDVIGFFNEREADLKSQYEDKKKFVKEMRDTPEFQSWMREIR--------------SYDQDTKEKL 848  baker's yeast
6323115  1142 KNNQELDQEYRSCETQDeseikdaetscdnyhpmnidetsdevsrgiprlsedeLRELDVELIESKinelSYYVEETNvd 1221 baker's yeast
19074461  764 KEMEARAED---------------------------------------------EIKREIAYIKAQ----AEMCRGIGde 794  Encephalitozoon c...
19173313  785 VSDFRNLERLYPDKKKE-------------------------------------EIMNEMARINER----TRGLSVVN-- 821  Encephalitozoon c...
19075000  787 TEEYDKILAQLPDTID----------------------------------------ELDDEIIKER-----AQLKLYNvd 821  Encephalitozoon c...
19114172  932 KSLGVLPEEAFIKYVSTss----------------------------------nAIVKKLHKINEA----LKDYGSVN-- 971  fission yeast
8489009   816 SDRQTAITELNEEFATSs------------------------------------EVDNKISIEETK-----LKFMNVN-- 852  fission yeast
1709997   911 SPAELDNEIERLQMQIA-------------------------------------EWRNRTGVSVEQ-----AAEDYLN-- 946  fission yeast
730753    948 LVRNIVKQNEGIDLDTY--------------------------------------RERSKQLNEKF----QELRKKVN-- 983  baker's yeast
1352989   955 REIGLLPEDALVNDFSDit---------------------------------sdQLLQRLNDMNTE----ISGLKNVN-- 995  baker's yeast
6324539   849 NKVAEKYEEEGNFNLS--------------------------------------FVQDVLDKLESE-------IAMVNhd 883  baker's yeast
6323115  1222 IGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLD- 1300 baker's yeast
19074461  795 EKALGTLEHLKRMRRGKEDLLREYDEKIRTALEGIESRIVKRDSMRNEIARRAAEEFSRLTKAR--GYEGALEFDHQKK- 871  Encephalitozoon c...
19173313  822 RAAISQWENYMEQRDSMKRRLEDLKCDKRRILDFIAELDSKKEDTMKNAISLVKEGFSELYSRLTDGGTAELYSYEN--- 898  Encephalitozoon c...
19075000  822 RGAVEQFEVREQDLRSLNKDISRHSEGLENIKKKGSDVKNVLIERIEKMVCSIDKQFRSLFRRAGGDGSVVFINDGLDAc 901  Encephalitozoon c...
19114172  972 KKAYEQFNNFTKQRDSLLARREELRRSQESISELTTVLDQRKDEAIERTFKQVAKSFSEIFVKLVPAGRGELVMNRRSEl 1051 fission yeast
8489009   853 SYVMEQYDARKKEIEELESKMSDFDQSVEELQDEMNSIKEDWVSKLEENVQCISDRFSKGMSGMGY--AGEVRLGKSDD- 929  fission yeast
1709997   947 --AKEKHDQAKVLVARLTQLLQALEETLRRRNEMWTKFRKLITLRTKELFELYLSQRNFTGKLVIK---HQEEFLEPRVy 1021 fission yeast
730753    984 PNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCE-GK- 1061 baker's yeast
1352989   996 KRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDn 1075 baker's yeast
6324539   884 ESAVTILDQVTAELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGS--AGAVRLEKPKD- 960  baker's yeast
6323115  1301 P--------------------------FS--EGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350 baker's yeast
19074461  872 ---------------------------RL---DVQLRVHGQSEVGS---RSMLSGGERSFASVSLLLSLWPSLSCPIKVL 918  Encephalitozoon c...
19173313  899 --------------------------------GIGIKIGENISANL------LSGGQKAVVALCLIFSMQRVSPSPLYVL 940  Encephalitozoon c...
19075000  902 Kw------------------------rLS--IMVKFRDSDGLEVLN---SHRQSGGERSVSIILFLLAIQSYRPSPFRLV 952  Encephalitozoon c...
19114172 1052 Sqsieqdismd-------idtpsqkssIDnyTGISIRVSFNSKDDEqlNINQLSGGQKSLCALTLIFAIQRCDPAPFNIL 1124 fission yeast
8489009   930 ---------------------------YDkwYIDILVQFREEEGLQklTGQRQSGGERSVSTIMYLLSLQGLAIAPFRIV 982  fission yeast
1709997  1022 P------------------------------ANRNLATAHNRHEKSkvSVQGLSGGEKSFATICMLLSIWEAMSCPLRCL 1071 fission yeast
730753   1062 D--------------------------VT--QGLEVKVKLGNIWKE--SLIELSGGQRSLIALSLIMALLQFRPAPMYIL 1111 baker's yeast
1352989  1076 AndhdesidvdmdaesnesqngkdseiMY--TGVSISVSFNSKQNEqlHVEQLSGGQKTVCAIALILAIQMVDPASFYLF 1153 baker's yeast
6324539   961 ---------------------------YAewKIEIMVKFRDNAPLKklDSHTQSGGERAVSTVLYMIALQEFTSAPFRVV 1013 baker's yeast
6323115  1351 DEIDAALDFRNVSIVANYIKERT---KNAQFIVISLRNNMFELAQQLVGVYKRD---NRTKSTTIKNIDILNRT 1418 baker's yeast
19074461  919 DEFDVFMDNLNRKHAIRQLLGFFk-eNGFQGILITPLSIEDLFEDFCDVVVLDKa--GRDEHIER--------- 980  Encephalitozoon cuniculi
19173313  941 DEIDANLDVQSRERVSMLIKEMSt-sCGNQFIITTFRKELLSCGSKYLSVEFEEk---RSRVKEIEMVTAYRFL 1010 Encephalitozoon cuniculi
19075000  953 DEINQGMDRHNEKLVHDILVALSk-eGNEQFFMITPKIAPGLSYSQNMKVIILYs--SQSCAGQEGFVKYKLRM 1023 Encephalitozoon cuniculi
19114172 1125 DECDANLDAQYRSAIAAMVKEMS---KTSQFICTTFRPEMVKVADNFYGVMFNHk---VSTVESISKEEAMAFV 1192 fission yeast
8489009   983 DEINQGMDPRNERVVHRHIVNSVcdnAVSQYFLVTPKLLPDLTYHRNLKVLCICngaWLPATFRTSLSTYFEKL 1056 fission yeast
1709997  1072 DEFDVFMDAVNRLVSIKMMVDSAkdsSDKQFIFITPQDMGQIGLDKDVVVFRLSd-pVVSSSALPPSTAP---- 1140 fission yeast
730753   1112 DEVDAALDLSHTQNIGHLIKTRF---KGSQFIVVSLKEGMFANANRVFRTRFQD---GTSVVSIM--------- 1170 baker's yeast
1352989  1154 DEIDAALDKQYRTAVATLLKELS---KNAQFICTTFRTDMLQVADKFFRVKYEN---KISTVIEVNREEAIGFI 1221 baker's yeast
6324539  1014 DEINQGMDSRNERIVHKAMVENAcaeNTSQYFLITPKLLTGLHYHEKMRIHCVMagsWIPNPSEDPKMIHFGET 1087 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap