Conserved Protein Domain Family
NirB

?
COG1251: NirB 
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion]
Statistics
?
PSSM-Id: 224171
View PSSM: COG1251
Aligned: 24 rows
Threshold Bit Score: 747.22
Threshold Setting Gi: 15605766
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15839633   11 AAAREIVVVGHGMVGHRLVEAVRArDADGSLRITVLAEEGDAAYDRVGLTSYTES-WDRALLALPGNDYAGDQRVRLLLN 89   Mycobacterium tub...
15891060   23 TMTQKLVIIGNGMAPGRMLENLFE-TAPGLYDVTIFNAEPRVNYDRIMLSPVLSGeKSYEDIVIHNDEWYAANNVTLHKG 101  Agrobacterium tum...
1171659     1 MKKQRLVLAGNGMAGIRCIEEVLK-LNRHMFEIVIFGSEPHPNYNRILLSSVLQGeASLDDITLNSKDWYDKHGITLYTG 79   Bacillus subtilis
15895713    1 MKSTKILILGAGPAGFSAAKAALG----KCDDITMINSEKYLPYYRPRLNEIIAKnKSIDDILIKKNDWYEKNNIKVITS 76   Clostridium aceto...
16124868    5 TPKLRLVVIGNGMAGCRAVEEVLK-RDPDRYAVTIFGAEPRVNYNRIMLSPVLAGeKAFEDIVINDEAWYRDNGITLHAG 83   Caulobacter cresc...
15596978    1 MKKIKLVMVGNGMAGVRTLEELLK-LNSDFYDITVFGAEPHPNYNRILLSPVLAGeQTFEEIVLNDLNWYAENGIKLLLD 79   Pseudomonas aerug...
17549441    4 AARPKLVVIGNGMAGMRTVEELLK-LAPDLYDITVFGEEPHGNYNRILLSPVLAGeKRVDDIMLNTREWYEEHGITLHAG 82   Ralstonia solanac...
16264857    4 TAREKLVIVGNGMAPGRMLEELFE-KAPGRYAVTIFNAEPRVNYDRIMLSPVLSGeKEYEEIIIHGDGWYIKHGITLYKG 82   Sinorhizobium mel...
15605766    1 ---MKVVIVGNGIAGTALVEEILRlSSGKDIRIQVFGDEKFIGYNRVLITEVLAGrKTLSEIYIKRWQWYEEKGVRLEIG 77   Aquifex aeolicus
13472534    1 -MTERLVIIGNGMAPGRMLEHLLE-QAPSRYSVTIFNAEPRVNYDRIMLSPVLSGeKAYEEIIIHGDGWYIANNITLYKG 78   Mesorhizobium loti
15839633   90 TRVTQIDRATKSVVTAAGQRHRYDTLVLATGSYAFVPP-VPGHDLPACHVYRTFDDLDAIRAGaQRTLDGghtdgGVVIG 168  Mycobacterium tub...
15891060  102 AKVTRIDRANKIVTSENGITASYDRLVIATGSLPFIIP-VPGHQLPGVLAYRDLDDVTKMLEI-AKGKGR-----AIVIG 174  Agrobacterium tum...
1171659    80 ETVIQIDTDQQQVITDRKRTLSYDKLIVATGSSPHILP-IPGADKKGVYGFRTIEDCQALMNM-AQHFQK-----AAVIG 152  Bacillus subtilis
15895713   77 EFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIK-VPHAD--EIFSLYSYDDALKIKDE-CKNKGK-----AFIIG 147  Clostridium aceto...
16124868   84 RAVTAIDLAARKVFAEGGLEIGYDKLILATGSDPFRLP-LPGGDLKGVVTFRDLDDVNAMLAAsAEPDAR-----AVVIG 157  Caulobacter cresc...
15596978   80 RKVVQIDRLRRRVVAADGSEAEYDRLLLATGSLPFILP-IPGNRLQGVIGYRDIADTQAMIDC-ARTHSH-----AVVIG 152  Pseudomonas aerug...
17549441   83 DPVVAIDRPRRTVRSRGGVEVRYDRLLMATGSRPFILP-VPGHMLPGVIAFRDIQDVETMLDA-ARNHRH-----AVVIG 155  Ralstonia solanac...
16264857   83 HKIIAIDRDAKTVTSDHGVTESYDKLVIATGSVPFIIP-VPGKELRGVITYRDLDDVQAMLLA-AQSREK-----AVVIG 155  Sinorhizobium mel...
15605766   78 KKVERLFPNKKILVTKDGEFYRYDKAIIATGSKPFIPPsIKGVNKKGVFTYRTAKDVFEILDY-ARVSKR-----AVVIG 151  Aquifex aeolicus
13472534   79 HKIVAIDRAAKTVTSDHGVTEPYDKLVIATGSVPFIIP-VPGHNLPGVLTYRDLDDVQAMMLA-AQSRAK-----AVVIG 151  Mesorhizobium loti
15839633  169 GGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHVgtGTESIESVKhsdGSVWARVRLSDG 248  Mycobacterium tub...
15891060  175 AGLLGLEAAYGLKRQGMDVTVIHLMPTIMERQLDPAAAYLLEKALNERGIDIIT--KANTKCILG---EEKVEGIELEDG 249  Agrobacterium tum...
1171659   153 AGLLGLEAAVGLQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLL--EKDTVSISG---ATKADRIHFKDG 227  Bacillus subtilis
15895713  148 GGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYT--NSNFEEMG--------DLIR---- 213  Clostridium aceto...
16124868  158 GGLLGLEAAYGLARRGMAATVVHLMDVLMERQLDESAGYLLREALADRGVETVL--GAHSEEIVGa--DGQVTGLKLKDG 233  Caulobacter cresc...
15596978  153 GGLLGLEAANGLKQRGMDVTVVHLSDWLLERQLDRTAGKLLQGALEARGIRFRL--NTQTQELMDn-gSGRVCAVQFNDG 229  Pseudomonas aerug...
17549441  156 GGLLGLEAANGLMRQGMEATVVHISDTLMERQLDKPAAALLKVALEAKGLRFLL--GAQTTELIg---TDRVTAVRFKDG 230  Ralstonia solanac...
16264857  156 GGLLGLEAAAGLQARGMDVTVLHVMPTLMERQLDPAAGYLLQKAVEERGIKVVT--KANTKRILG---EEKVEGIELDDG 230  Sinorhizobium mel...
15605766  152 GGLLGIEVTKALRDIGLEVFLVHILDTLMEQQLDKTASELLRKDLEDMGIKVLL--KKVTEEILG---EKKAEGVRFSDG 226  Aquifex aeolicus
13472534  152 GGLLGLEAAAGLNAQGMDVTVLHVMPTLMERQLDPAAGYLLQRAVEQRGIKVIT--KANTQAITG---NGKVEQVELADG 226  Mesorhizobium loti
15839633  249 EVIDAGVVIFAAGIRPRDELARAAGLAIGDrgGVLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLD 328  Mycobacterium tub...
15891060  250 RIIKGDMVVMAVGIRPASGLAKEAGIAVNR--GIVVDDGMMTSDASIYALGECAEHRGMCYGLVAPLYESARVLADRLCG 327  Agrobacterium tum...
1171659   228 SSLKADLIVMAAGVKPNIELAVSAGIKVNR--GIIVNDFMQTSEPNIYAVGECAEHNGTVYGLVAPLYEQGKALASHICG 305  Bacillus subtilis
15895713  214 ----SSCVITAVGVKPNLDFIKDTEIASKR--GILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACG 287  Clostridium aceto...
16124868  234 RVLPCDLLVMAVGIRPNTTLAKAAGLTVNR--GVAVDDAMRTSDPDVFAVGECVEHRGQCYGLVAPIWEMCRALAQALTD 311  Caulobacter cresc...
15596978  230 DVIPADLVVMAAGIRPNTELAESAGIPCNR--GILVNDTLQTYDPRIYAVGECANHRGIAYGLVAPLFEQAKVCANHLAH 307  Pseudomonas aerug...
17549441  231 TEIPADLVVMTAGVRPNIELARSAGLHCER--AIVVDDTLQTYDPRIYAVGECVQHRSATFGLVAPIWDQARVCAAHLAG 308  Ralstonia solanac...
16264857  231 RIIPATLVVMAVGIRPNAGLAKEAGLAVNR--GIVVDAGMQTSDGDIMALGECAEVGGMVYGLVAPLYEMARVAASHLAG 308  Sinorhizobium mel...
15605766  227 DELLADFVIIATGIRPNVEVGVNSGLKVNK--GIVVNDYLETSASDIYAVGECIEHRGKTYGLVAPIMEQVKVCAHNVVH 304  Aquifex aeolicus
13472534  227 TVIPATLVVMAVGIRPNSALAKEAGIAVNR--GIVVDAGMRSNDPDIYALGECAEVNGMVYGLVAPLYEMARVAAHQLAG 304  Mesorhizobium loti
15839633  329 GSA-EFPEADLSTKLKLLGVDVASFGDAMgATENCLEVVINDAVKRTYAKLVLSDDatTLLGGVLVGDASSYGVLRPMVG 407  Mycobacterium tub...
15891060  328 G-SaEYHGSVTNTKLKVTGINLFSAGDFA-EGDDREEIVLRDATAGVYKRLILKEN--RIIGAVLYGETADGSWFFDLMK 403  Agrobacterium tum...
1171659   306 VPCeEYQGSAPSAALKIAGIDVWSAGKIQ-EDERTTSIKIYDEQAGVYKKALFVDD--KLR-VILFGDTRDKQRLLDSLL 381  Bacillus subtilis
15895713  288 EDAs-YSEIIPSPILKVSGISIISCGDIE---NNKPSKVFRSTQEDKYIVCMLKEN--KIDAAAVIGDVSLGTKLKKAID 361  Clostridium aceto...
16124868  312 G-EgAYQGSVLSTRLKVSGVDVFSAGKFA-GGEGCEDIVFRDAARGVYKRVVIEDG--KVAGAVLFGDAADGGWYFDLMK 387  Caulobacter cresc...
15596978  308 LGYaRYQGSVTSTKLKVTGIDLFSAGDFI-GGEGSETITLSDPIGGVYKKLVIKDD--VLVGACLYGDTADGGWYFRQIR 384  Pseudomonas aerug...
17549441  309 AGHrRYVQQATATKLKVTGVDLYSAGDFI-GGDGTEDIVLRDPRRGVYKRLVLKDD--RIVGAVLYGDVADGPWYFELIQ 385  Ralstonia solanac...
16264857  309 DRRaAFAHSDTPTKLKVTGINLYSVGDFA-DADGREEIVLRDATAGIYKRLVLKDN--RIIGTVLYGDTADGAWFNDLLK 385  Sinorhizobium mel...
15605766  305 GNEkKYTGSLTYAMLKVAGVNLFSAGEIN-EKDGDEVVAFLDNGRSLYRKAVIRNN--KIVGTILYGDVRGNNYLLDLIK 381  Aquifex aeolicus
13472534  305 NEAaAFVHMDTPTKLKVTGIDLFSLGDFA-EGEDRQEIVLRDAAAGVYKRLVLKDD--RIIGTVLYGETADGAWFNDLKK 381  Mesorhizobium loti
15839633  408 --AELPGDPLALIAPAGSga----gAGALGVGALPDSAQICSCNNVTKGELKCAIA-DGCGDVPALKSCTAAGTSCGSCV 480  Mycobacterium tub...
15891060  404 ksTDISAMRETLIFGQAYqgg-splDPMAAVAALPDDAEICGCNGVCKGKITSAITsKGLTSLDDVRAHTKASASCGNCT 482  Agrobacterium tum...
1171659   382 kqRDISIAKKQIIEPETS-------GP--LFESMPSSETICQCNTVTKGAIEDAVHtNSLTTVEEVKHCTKATGSCGGCK 452  Bacillus subtilis
15895713  362 ssKSFDNISSLDAILNNL-------------------------------------------------------------- 379  Clostridium aceto...
16124868  388 agADVAGIRETLIFGQAIteglsglDPSAAVAAMPDTQEICGCNGVCKGAITSAITaQGLTTLDDVRAVTKASASCGSCT 467  Caulobacter cresc...
15596978  385 enHNVAQIRDHLMFGENAlgdvghqGQ-NSAASMPDTAEVCGCNGVCKGTIVKAIQeHGLFSVDEVKKHTKAASSCGSCA 463  Pseudomonas aerug...
17549441  386 rqAPIAAMRQRLLFGR-Alc-------eaEAA------------------------------------------------ 409  Ralstonia solanac...
16264857  386 rgTDISEMRDTLIFGQAYqgg-splDPTAAVAALPDDAEICGCNGVCKGKIVGAITsKGLTSLDDVRAHTKASASCGSCA 464  Sinorhizobium mel...
15605766  382 sgKDISEERPYFLIKHILp------KGTTGVEELKDNDIVCNCNAVTKGEIVKCIK-EGCKTLEEIQERTKASTSCGSCI 454  Aquifex aeolicus
13472534  382 kqTDISQMRDTLIFGQSYqgg-aplDPMAAVAALPDDAEICGCNGVCKGKITGAITaKGLTSLDDVRAHTKASASCGSCT 460  Mesorhizobium loti
15839633  481 PLLKQLLEAEGVEQ-------SKALCEHFSQSRAELFEIITATEVRTFSGLLDRFGRGK--GCDICKPVVASILASTGSD 551  Mycobacterium tub...
15891060  483 GLVEQLMTLTLGDTynp--aaVQPMCKCTDLGHDDVRRLIKAKGLKTIPAVMQELEWKTscGCAKCRPALNYYLVCDFPD 560  Agrobacterium tum...
1171659   453 PLVEDLLRYMTNSEytk-pasTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTknGCSTCVPAIQYYLEMLYPG 531  Bacillus subtilis
15895713      --------------------------------------------------------------------------------      Clostridium aceto...
16124868  468 PLVEQVLKLTLGDGfqa-qtgPKPICKCSPKTHGDVRRAIVDQGLKSMPAVMQALEWSTpdGCASCRPALNYYLLCAWPG 546  Caulobacter cresc...
15596978  464 GLVEQILISTVGGAadvkpksEKAICGCSDLNHGQIRKAIREHRLTSLDAAMRFMDWKTpnGCATCRPALNYYLISTWPG 543  Pseudomonas aerug...
17549441      --------------------------------------------------------------------------------      Ralstonia solanac...
16264857  465 GLVEQIMSLTLGDTynp--asVQPMCNCTDLGHDDVRRLIKAKKLKSIPAVMQELEWKTscGCAKCRPALNYYLVCDWPD 542  Sinorhizobium mel...
15605766  455 ELVEEILKHYVKEKpkrvnkievikkelhpfdlefkkrlekyfsegelenipeedrdvrlkwygifyrkatpgyfmvrir 534  Aquifex aeolicus
13472534  461 GLVEKLMVLTLGDSynp--aaVQPMCTCTTLGHDEVRRLIKAKHLKTIPAVMQELEWKTscGCAKCRPALNYYLVCDWPD 538  Mesorhizobium loti
15839633  552 HILDGEQASLQDSNDHflANIQKNGSYSVVPRVPGGDIKPEHLILIGQIAQDFVLYT-KITGGQRIDLFGARVDQLPLIW 630  Mycobacterium tub...
15891060  561 EYADDYQSRYINERVH--ANIQKDGTYSVVPRMWGGVTNADELRAIADVVDKFEIPLvKVTGGQRIDLLGIEKEDLPAVW 638  Agrobacterium tum...
1171659   532 FVQPEPAT---------------EETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDvSITHGQRLKLSGIKPADLPNMK 596  Bacillus subtilis
15895713      --------------------------------------------------------------------------------      Clostridium aceto...
16124868  547 EYRDDKQSRYINERVH--ANIQKDGTYSVVPRMWGGMTSPAELRAIADVAEKFAIPAvKVTGGQRIDLLGVKKDDLPAVW 624  Caulobacter cresc...
15596978  544 EAKDDPQSRLINERAH--ANIQKDGTYSVVPRMWGGVTNAAELRRIADVADKYQVPMvKVTGGQRIDLLGVKKDDLPAIW 621  Pseudomonas aerug...
17549441      --------------------------------------------------------------------------------      Ralstonia solanac...
16264857  543 EYADDYQSRFINERVH--ANIQKDGTYSVVPRMWGGVTNSKELRAIADVVDKFNVPLvKVTGGQRIDLLGIEKEDLPAVW 620  Sinorhizobium mel...
15605766  535 vpngrlsyeqakvvshisekfcrgeveitsrqqlqirwiklkdlpeilealnrvglstlqtgmdnvrnvtgdpltglaed 614  Aquifex aeolicus
13472534  539 DYADDYQSRFINERVH--ANIQKDGTYSVVPRMWGGVTNAAELRAIADVVDKFEIPMvKVTGGQRIDMLGIRKEDLPAVW 616  Mesorhizobium loti
15839633  631 QRLVDGgmeSGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGCARECAEARGKDVGVIA 710  Mycobacterium tub...
15891060  639 ADLGKAgfiSGQAYAKGLRTVKTCVGEQWCRFGTQDSTGLGIRIEKFMWGSWTPAKLKLAVSGCPRNCAEATCKDIGVIC 718  Agrobacterium tum...
1171659   597 KDLKMPv--YTNEHRHALQSIKACT----CGQ-NRSIQQLAAQIERQLEMLPLPAPISISLS-CETDCTEAALQDVGAIR 668  Bacillus subtilis
15895713      --------------------------------------------------------------------------------      Clostridium aceto...
16124868  625 ADLNAAgmvSGHAYAKGLRTVKTCVGSDWCRFGTQDSTGLGMRLEKFLWGSWAPAKVKLAVSGCPRNCAEATCKDFGVVC 704  Caulobacter cresc...
15596978  622 KDLDMP---SGHAYGKSIRTVKTCVGSEFCRFGTQNSTQLGIDLEHDLFNMWSPHKVKLAVSGCPRNCAEAGIKDVGIIG 698  Pseudomonas aerug...
17549441      --------------------------------------------------------------------------------      Ralstonia solanac...
16264857  621 ADLGQAgfvSGQAYAKGLRTVKTCVGSDWCRFGTQDSTGLGIRIEKFMWGSWTPAKLKMAVSGCPRNCAEATCKDVGVIC 700  Sinorhizobium mel...
15605766  615 slidtlrlsqeitniflgkkkyadlprklnvavlgsqtdcinalfndvcfylsekdgklgfnlylggkigsggpkkaidm 694  Aquifex aeolicus
13472534  617 ADLGQAgfvSGHAYAKGLRTVKTCVGSDWCRFGTQDSTGLGIRIEKFMWGSWTPAKVKMAVSGCPRNCAEATCKDVGVIC 696  Mesorhizobium loti
15839633  711 TEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYYIRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEF 790  Mycobacterium tub...
15891060  719 VDSGFEIHFAGAAGLDIKGTEVLGLVHTEDEALEHIVALTQMYREQARYLERIYKWAKRIGYDEVRRQIMDDADKRKAYF 798  Agrobacterium tum...
1171659   669 TQAGWDIHIGGVRGTHARSGALFCVTENEDSTAGMIKGLIQYYRETDHYLEGVHQWIDRLGIVHIRE-VLFEEDLRAQLL 747  Bacillus subtilis
15895713      --------------------------------------------------------------------------------      Clostridium aceto...
16124868  705 VDSGYEIHIGGAAGLHIQGTQVLTRVATEDEAVWVIAAAMQLYREEGWYLERVYKWMDRVGLESIRAQVTD-PDQRRALY 783  Caulobacter cresc...
15596978  699 VDSGWEMYIGGNGGIKTEVAEFFVKLKTAEEVREYNGAFLQLYREEAFYLERTVHYLQRVGMEHIRKAVVEDAENRKALN 778  Pseudomonas aerug...
17549441      --------------------------------------------------------------------------------      Ralstonia solanac...
16264857  701 VDSGFEIHFAGAAGLDIKGTEVLGLVRTEDEALEHIVALTQMYREQARYLERIYKWAKRVGLDEIRRQIMDDVEKRKAYF 780  Sinorhizobium mel...
15605766  695 dmfvepyevpevfkatldiystfgnrenrsknrlyfllqewgverfreelekrlykaipskgkdlvnktgeregiinlrn 774  Aquifex aeolicus
13472534  697 VDSGYEIHFAGAAGLDIKGTEVLGLVKTEDEALEHIVALTQMYREQGRYLERIYKWAKRIGIPEIKRQIMDDDAKRKTYY 776  Mesorhizobium loti
15839633  791 EAAMQRHVANYkCEWKGVLEDPDKLSRFVSF 821  Mycobacterium tuberculosis CDC1551
15891060  799 DRFVFSQKFAQvDPWSERVSGHDKHEFRPMA 829  Agrobacterium tumefaciens str. C58 (Cereon)
1171659   748 ESLQTDLSLIQ-NPTVETGAYKKG------- 770  Bacillus subtilis
15895713      -------------------------------      Clostridium acetobutylicum
16124868  784 DRFVYSQRFARiDPWAERVAGRHNEEFTPMS 814  Caulobacter crescentus CB15
15596978  779 DRLQFALSFEQ-DPWKQRIEQPQLKKEFERI 808  Pseudomonas aeruginosa PA01
17549441      -------------------------------      Ralstonia solanacearum
16264857  781 DRFVFSQKFAQvDPWSERVSGKDKHEFRPMA 811  Sinorhizobium meliloti
15605766  775 gtyavcvvvpagkikakdfrqiaelarkygs 805  Aquifex aeolicus
13472534  777 ERFVFSQKFAQvDPWSERVSGKDKHEFRPMA 807  Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap