Conserved Protein Domain Family
PMT1

?
COG1928: PMT1 
Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 224839
View PSSM: COG1928
Aligned: 17 rows
Threshold Bit Score: 323.673
Threshold Setting Gi: 19552115
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6093748   11 KEKHRIQRDVkLSRPRKRFSFLDY-VVVIFLTVVAFCVRAQRLMNPAKVVFEELRYYNYAVDYVNNKLLMDV-YPPLGKL 88  fission yeast
19552115   1 ------MSQAlPVRDQGRDQGIFAgTLPPAPPKFKWTRLDTYTWAIIAVFALVTRFTGLSSATASGTPVFDEkHYVPQAW 74  Corynebacterium glu...
15827001   1 --------------MISPGPLVP-----VEDFGPTDDVRGWIATGVITVLATGTRFINLSSPTDAGTPIFDEkHYAPQAW 61  Mycobacterium leprae
21542299   1 -----------MVPVVSPGPLVP-----VADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEkHYAPQAW 64  Mycobacterium tuber...
21542299   1 -----------MVPVVSPGPLVP-----VADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEkHYAPQAW 64  Mycobacterium tuber...
1709693   22 LRSFLITKPCdNLSSLRTVTSSKEkLLVGCLLIFTAIVRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDV-HPPLVAM 100 baker's yeast
461956    26 VRPFIVTDPSaELASLRTMVTLKEkLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDV-HPPLAKM 104 baker's yeast
1172543   44 QLEEKHRTKK--NEEYTALKILRDvIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDV-HPPLGKM 120 baker's yeast
6324897   39 DAELYDKVK-----NESAVSHLDTiVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDV-HPPLGKM 112 baker's yeast
16329627   1 -----------MLNQFPKLRLTPFtTGIVAIFLFSLVIRFWNLGQFNQLVFDEVYYAKFASDYWLGNDFFPS-HPPLSHY 68  Synechocystis sp. P...
6093748   89 LF------SLVAALTG-------NKYELNTLDEPGQQYPFTDVAYSMRLFTCLLGSLLVPLMYGTVYFPTKSKTAASLAA 155 fission yeast
19552115  75 DMvrswinPITGGIESnpgyglvVHPPLAKQLEALGEWVFGYTPLGWRIMVAIFGTLTIFAIMAIARRLSGSTMVTFIAG 154 Corynebacterium glu...
15827001  62 QL------LHNHGVEDnpgfglvVHPPIGKQLIAIGEAIFGYNGVGWRFTGALLGVIMVALVMRIVRRITRSTLIGTIAG 135 Mycobacterium leprae
21542299  65 QV------LNNHGVEDnpgyglvVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAG 138 Mycobacterium tuber...
21542299  65 QV------LNNHGVEDnpgyglvVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAG 138 Mycobacterium tuber...
1709693  101 LY------ATVSSVFG-------YKGLFNYGNIG-TEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICA 166 baker's yeast
461956   105 LY------AGVASLGG-------FQGDFDFENIG-DSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSA 170 baker's yeast
1172543  121 LI------ALSEWMAG-------FDGQFDFSSN--NAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIA 185 baker's yeast
6324897  113 LV------GLSGYLAG-------YNGSWDFPSG--EVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFT 177 baker's yeast
16329627  69 LI------ALAMGLGq-------VFPVNPEQVNDLTGAVR--STWSYRWLNALTGATIPLLLGAIAYLLTQRRLVTLLTM 133 Synechocystis sp. P...
6093748  156 LFVIFDNGLITMSRYIMIEIPALYFMSLTAFYWSVYEAQQkrPFSLRWHTSLLSTG----VALGLALSTKLSAMFTFGWL 231 fission yeast
19552115 155 ILALADGVLLVSSRFGMLDIFLVFFITAAAWALIRDHQQM-----HQRLNDLLLTNgqitKDFGPRFGFRWWR-FTTGVF 228 Corynebacterium glu...
15827001 136 LLVICDGVSFVTARTALLDGFLTFF-VVATFGALIVDRDQ----VRQRMHTAITEGrsteTVWGPRLGVRWWR-FLGGIL 209 Mycobacterium leprae
21542299 139 VLLICDGVSFVTARTALLDGFLTFF-VVAAFGALIVDRDQ----VRERMHIALLAGrsaaTVWGPRVGVRWWR-FGAGVL 212 Mycobacterium tuber...
21542299 139 VLLICDGVSFVTARTALLDGFLTFF-VVAAFGALIVDRDQ----VRERMHIALLAGrsaaTVWGPRVGVRWWR-FGAGVL 212 Mycobacterium tuber...
1709693  167 VCFAIENSFVTLSRFTLIEGPFVFFMACAVYFFRRSELYL--PNSCKANKSLLAAS----IALGFAVSSKWAGLFTIAWA 240 baker's yeast
461956   171 ICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYP--ANSLNAYKSLLATG----IALGMASSSKWVGLFTVTWV 244 baker's yeast
1172543  186 TMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRkqQMTKKWSLWMLLTG----LSIGCVCSVKWVGLFITVVV 261 baker's yeast
6324897  178 ILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRksPFSARWWLWLCLTG----LNLGCAISVKMVGLFIISVV 253 baker's yeast
16329627 134 GLVALDGLFLVESRYALNNIYLVFFGLLGQALVLWHLR-------QEKLWQLILGG----ISLACAGSVKWN-----GFA 197 Synechocystis sp. P...
6093748  232 LILAAFHLWNLLGDLSVPMYRIVKHLFSYIFYLIGVPITVYLAVFAVHSHIAYKASVADAFLPPEHRHALAGNRFDDQFA 311 fission yeast
19552115 229 LGLALSVKWSGLYYIA-------------FFGLTSVFLDLWLRKR-YGVRRYVTGTLKNDVIPALGSLVIIPALLYIWSW 294 Corynebacterium glu...
15827001 210 LGLACATKWSGLYFVL-------------FFGVMSLAFDVSSRRQ-YQVLNPWRGVLRRDVIPTVYALGLISFLVYITSY 275 Mycobacterium leprae
21542299 213 LGLACATKWSGVYFVL-------------FFGAMALAFDVAARRQ-YQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATY 278 Mycobacterium tuber...
21542299 213 LGLACATKWSGVYFVL-------------FFGAMALAFDVAARRQ-YQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATY 278 Mycobacterium tuber...
1709693  241 GIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETV 320 baker's yeast
461956   245 GLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVV 324 baker's yeast
1172543  262 GLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLYCFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPR 341 baker's yeast
6324897  254 GIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPR 333 baker's yeast
16329627 198 FLLGVYLLWAIAWVKP-------------FFNQGWTKGERQANS--LQLL-DRDGENNQGFLSRWLIISPLKFAIWLV-L 260 Synechocystis sp. P...
6093748  312 DVAYG-SLVTIRNAIPEH-GYLHSSELLYPEGTEQQIISLVDEPNQNALWIIEhe----hSQD---NNRSNIELLKDGSV 382 fission yeast
19552115 295 RAWFAsETSVYRHAKTDGtITEDSILQLFPEs------------------------------------------------ 326 Corynebacterium glu...
15827001 276 APWFAsETAIDRHQVGQT-IGRHGMIPLPDA------------------------------------------------- 305 Mycobacterium leprae
21542299 279 APWFAsETAIDRHAVGQA-VGRNSVVPLPDA------------------------------------------------- 308 Mycobacterium tuber...
21542299 279 APWFAsETAIDRHAVGQA-VGRNSVVPLPDA------------------------------------------------- 308 Mycobacterium tuber...
1709693  321 AEVAVgSAVSLNHVGTAG-GYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIE-------LAEhpnENVTSFQNLTDGTI 392 baker's yeast
461956   325 ADVGIgSIISLRHLSTMG-GYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLE-------LYNapgESLTTFQNLTDGTK 396 baker's yeast
1172543  342 DVAFG-SELTIRSHGLSP-NLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEfsrssglELDqngTLNGKIIPITDGVE 419 baker's yeast
6324897  334 DVALGsSIISIKNQALGG-ALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQrir--gvEPWtdaENKT-IEFVKGGEM 409 baker's yeast
16329627 261 VPVITySVIWIPH---------LLMNGEYAS------------------------------------------------- 282 Synechocystis sp. P...
6093748  383 VRLRHVMTGRALHSHEHKPIVSNNd-wQLEASAYGGFgFEGDANDLFRIQILEKKs-----kHATSNGTVETLNTKFRLI 456 fission yeast
19552115 327 IAGWIHYHISVLEFHGSLTTSSGH---------------------------------------------SHPWDSKP--- 358 Corynebacterium glu...
15827001 306 VRSLWYYHAKTLQFHAGLTNSAGN---------------------------------------------YHPWESKP--- 337 Mycobacterium leprae
21542299 309 VRSLWHYTAKAFHFHAGLTNSAGN---------------------------------------------YHPWESKP--- 340 Mycobacterium tuber...
21542299 309 VRSLWHYTAKAFHFHAGLTNSAGN---------------------------------------------YHPWESKP--- 340 Mycobacterium tuber...
1709693  393 IKLRQLKNGCRLHSHDHKPPVSQNadwQKEVSCYGYEgFEGDINDDWIIEIDKKRs-----ePGPAQEHIRAIETKFRLK 467 baker's yeast
461956   397 VRLFHTVTRCRLHSHDHKPPVSESsdwQKEVSCYGYSgFDGDANDDWVVEIDKKNs-----aPGVAQERVIALDTKFRLR 471 baker's yeast
1172543  420 VRLSHKNTGSNLHSHDVPSHVSRG---NYEVSGYGSQ-SVGDEKDDWIVEIVKQMdspnpvySNENSTILHPVSTFFRLR 495 baker's yeast
6324897  410 YRLMHRLTGKNLHTHEVPAPISKS---EYEVSAYGDV-DLGDYKDNWIIEIVEQV-------GEEDPTLLHPLSTSFRIK 478 baker's yeast
16329627 283 LEGFWRIQRETWQYHRRV-GNSPD---------------------------------------------IHPYCSPW--- 313 Synechocystis sp. P...
6093748  457 HVFANCELMSSHRRFPDWGDYQREVTCCRNc--VERSTTWFIESNYHDGLPsDSRKITYRKPGFLESFVEHNKLMWLKDR 534 fission yeast
19552115 359 ---------------WAWLVSGRPILYFSS------------TDISCD-------------------------------- 379 Corynebacterium glu...
15827001 338 ---------------WSWPMSLRPVLYAID------------QQDVPG-------------------------------- 358 Mycobacterium leprae
21542299 341 ---------------WTWPMSLRPVLYAID------------QQDVAG-------------------------------- 361 Mycobacterium tuber...
21542299 341 ---------------WTWPMSLRPVLYAID------------QQDVAG-------------------------------- 361 Mycobacterium tuber...
1709693  468 HYLTGCYLFSHPEKLPEWGFGQQEVTCAYFa--REDLTSWYIEENENEISLpNPEKVSYKKMSFWQKFVAIHKFMFYLNN 545 baker's yeast
461956   472 HAMTGCYLFSHEVKLPAWGFEQQEVTCASSg--RHDLTLWYVENNSNPLLPeDTKRISYKPASFISKFIESHKKMWHINK 549 baker's yeast
1172543  496 HKVLGCYLASTGLTYPAWGFKQAEIVCKDSwsrRDKSTWWNVEDHWNHNLE-TAEDYVPPKSNFWTDFILTNFAMASSNN 574 baker's yeast
6324897  479 NSILGCYLAQSGKHLPEWGFRQGEVVCLKHaskRDKRTWWNIETHENERLP-QGEDFVYPKTSFFRNFMQLNSAMMATNN 557 baker's yeast
16329627 314 ---------------YSWLLMARPIAYFYQ-------------------------------------------------- 328 Synechocystis sp. P...
6093748  535 KMGDGHV----YESSALTWPLLLGPLRFFY--EQHLQVFFMGNPFVWYSVISLVAFFVIVQIFCLARWNLGYNDFG-PSA 607 fission yeast
19552115 380 ----------------------------VGg-TCRRMIYLFGTPAIWWLTVPVILWAL----WSFFARRS---------- 416 Corynebacterium glu...
15827001 359 ----------------------------CGaqSCVKAEMLVGTPAMWWLAVPVLVYAT----WRTVIQRD---------- 396 Mycobacterium leprae
21542299 362 ----------------------------CGaqSCVKAEMLVGTPAMWWLAVPVLAYAG----WRMFVRRD---------- 399 Mycobacterium tuber...
21542299 362 ----------------------------CGaqSCVKAEMLVGTPAMWWLAVPVLAYAG----WRMFVRRD---------- 399 Mycobacterium tuber...
1709693  546 YMDTSHA----YSSEPKTWPLMLRGIDFWN--ENGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRdKHI 619 baker's yeast
461956   550 NLVEPHV----YESQPTSWPFLLRGISYWG--ENNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPILKdSKV 623 baker's yeast
1172543  575 ALVPDEDkydsLSSDAWEWPTLHKGLRMCSwaGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSdDQI 654 baker's yeast
6324897  558 ALVPNPEkfdgIASSAWQWPTLNVGVRLCEwsEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSdPVE 637 baker's yeast
16329627 329 ------K---------------------SGqfGLINDVHAMANPILLWFSTGAMALLTGTVIWQKIRQFS-SQTINaPLR 380 Synechocystis sp. P...
6093748  608 FHYN-YNIGKFVVAWLLHWAPYIL-ETDRVFLYHYLPALYFGIAALGVSWSFLGNA-------------VFGNRTAYKAL 672 fission yeast
19552115 417 -----RGYVVPLVAFAAGFLPWLAaYDRQMYFFYATALVPFTIIMLALACGELWGRgk----------mTPTGLTRGSMA 481 Corynebacterium glu...
15827001 397 -----WRYAAVLVGYCAGWLPWFAdIDRQMYLFYAATMAPFLVMGIALILGDILYPpwhdssprspsthSTERRTLRLIA 471 Mycobacterium leprae
21542299 400 -----WRYAVVLVGYCAGWLPWFAdIDRQMYFFYAATMAPFLVMGISLVLGDILYHpgq----------gsERRTLGLIV 464 Mycobacterium tuber...
21542299 400 -----WRYAVVLVGYCAGWLPWFAdIDRQMYFFYAATMAPFLVMGISLVLGDILYHpgq----------gsERRTLGLIV 464 Mycobacterium tuber...
1709693  620 INFHyQV-FQYLLGFAAHYFPYFF-VGQKLFLYDYLPAYYFGILAFGHALDLISTYi------------SNKRNNTGYIV 685 baker's yeast
461956   624 VNFHvQV-IHYLLGFAVHYAPSFL-MQRQMFLHHYLPAYYFGILALGHALDIIVSYv------------FRSKRQMGYAV 689 baker's yeast
1172543  655 WQITiQG-IFPFISWMTHYLPFAM-MGRVTYVHHYVPALYFAMLVFGFVLDFTLTR---------------VHWMVKYPI 717 baker's yeast
6324897  638 RDVFvMAAFYPLLAWLLHYMPFVV-MSRVVYAHHYLPTLYFALMILSYYFDMITKRwa----------tRNTGKFLRLGA 706 baker's yeast
16329627 381 G-----ITLYIEVNYAVNLLPWLG-ISRCTFFYHYLPAYAFSILALALILETLLDSp--------------R-HSHNVIA 439 Synechocystis sp. P...
6093748  673 SVIIMALMFLVYRLYSPFTYMTTLTKSSCRALELKGSWNFHCNT 716 fission yeast
19552115 482 VVTYISLVVMMFLAFSPLFYGFVIPDYVYESLMWFPSWR----- 520 Corynebacterium glutamicum ATCC 13032
15827001 472 VSCYVALVITNFVWLYPVLTGLPISHQTWNMEIWLPSWR----- 510 Mycobacterium leprae
21542299 465 VCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR----- 503 Mycobacterium tuberculosis
21542299 465 VCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR----- 503 Mycobacterium tuberculosis
1709693  686 VAIFMVVCFYFFSEHSPLIYATGWSSNLCKRSKWLGSWDFYCNS 729 baker's yeast
461956   690 VITFLAASVYFFKSFSPIIYGTPWTQELCQKSQWLSGWDYNCNT 733 baker's yeast
1172543  718 YLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIAP-- 759 baker's yeast
6324897  707 YIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVEDI 750 baker's yeast
16329627 440 WAVLTLVAIAFWYWL-PVFLGLPLTPRGFALRMLFPSWI----- 477 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap