1QGO


Conserved Protein Domain Family
CbiK

?
COG4822: CbiK 
Click on image for an interactive view with Cn3D
Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 227159
View PSSM: COG4822
Aligned: 5 rows
Threshold Bit Score: 382.592
Threshold Setting Gi: 15893872
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QGO_A     1 MKKALLVVSFGTSYHDTCEKNIVACERDLAASCPDRDLFRAFTSGMIIRKLRQRDGIDIDTPLQALQKLAAQGYQDVAIQ 80  Salmonella typhimurium
15893872   1 MKKGILIVGFGTIYKDARACTIDKIKEEVCKQFPDYEVLQAFTSSKIIEKIKETEGIDFDTPQKALHKFKNKAYREVIIQ 80  Clostridium acetobu...
15894652   1 MKKAILIISFGTTYENTRKLTIDAIEEKVKDEFKDYEIRRAFTSYKIIKVLKERDKIIVDTPGMALSRLKREGFEKVIVQ 80  Clostridium acetobu...
19704598  12 SKKALFMVHFGTTHNDTKELTIDKMNKKFADEFKDYDSFTAYTSRIVLKRLKDR-GEVFSTPIRVLNSLADQGYEELIVQ 90  Fusobacterium nucle...
16800234   1 MKKAILVVSFGTSYPETREKTIEACEKRVAQEFPEYTVFRAFTSNKIIKKLKTRDNMHINTPSQALNQLKELGYKEVFIQ 80  Listeria innocua
1QGO_A    81 SLHIINGDEYEKIVREVQLLRPLFTRLTLGVPLLSSH-------NDYVQLMQALRQQMPSLRQTEKVVFMGHGASHHAFA 153 Salmonella typhimurium
15893872  81 PIYMIPGYEYEKLIGTVDKYLKDFERLKIGRPVLYFKgnnknepNDYEIFLEKIKDMIP---KDKITVFMCHGTMHESNE 157 Clostridium acetobu...
15894652  81 PLHIIPGEEYDFVKRVVNEYSYDFKEIKLGRPVLYYKgitgefpDDYEIMVNSIKSIIP---RDEIVILMGHGSTHSSNA 157 Clostridium acetobu...
19704598  91 TSHVIPGIEYENLVREVNSFSNKFKSVKIGKPLLYYI-------DDYKKCVKALADEYVPKNKKEALVLVCHGTDSPLAT 163 Fusobacterium nucle...
16800234  81 SLHIINGGEFEKITAQVEKFKADFDSIIISQPLLDSK-------EDYEKAIEAIRHQMPPLKENEALILMGHGSKHHAFS 153 Listeria innocua
1QGO_A   154 AYACLDHMMTAQRF-PARVGAVESYPEVDILIDSLRDEGVTG-----VHLMPLMLVAGDHAINDMASDDGDSWKMRFNAA 227 Salmonella typhimurium
15893872 158 YYLKLDSFIKKHGFtSVVIATLEGFPKVEDVIEYMEKNKFKEkykgeVKIIPLLVTAGKHVKKDMQ----EEWVNIFKDK 233 Clostridium acetobu...
15894652 158 CYSCLQLVLRDNDFgNVFVANVEGYPDLNNVLRYIENHETRK-----VTLIPLMLVAGNHAVIDMAGNSEDSWKNILTSN 232 Clostridium acetobu...
19704598 164 SYAMIEYVFDEYGYdNVFVVCTKAYPLMDTLLKKLRKNGIEE-----VRLAPFMFVAGEHAKNDMA----VTYKEELEKN 234 Fusobacterium nucle...
16800234 154 AYACLDHMLLNE---PIYLCAVESYPGLDQVIERLKQAKIKK-----AHLMPFMLVAGDHATNDMASDDEDSWKSILEQA 225 Listeria innocua
1QGO_A   228 GIPA-TPWLSGLGENPAIRAMFVAHLHQALNMAVEEAA 264 Salmonella typhimurium
15893872 234 GYKV-ETYEHGLGEIYDFRSIYIQHIKDAIIRENYTAL 270 Clostridium acetobutylicum
15894652 233 GFEV-TAYVHGLGEVKEFQDIYIEHIKDVMEGRYEKEV 269 Clostridium acetobutylicum
19704598 235 GFKVnQVILKGLGEFDAIQNIFLDHLKSAIEKDEEDIA 272 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
16800234 226 GIET-ECHLQGLGENPLIQAQFIDHIKVATERVNTRG- 261 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap