Conserved Protein Domain Family
SAC6

?
COG5069: SAC6 
Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton]
Statistics
?
PSSM-Id: 227401
View PSSM: COG5069
Aligned: 4 rows
Threshold Bit Score: 785.285
Threshold Setting Gi: 19173149
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
462098     1 MNIVKLQ----RKFPILTQEDLFS-TIEKFRAIDLDDKGWVEKQQALEAVSKDGDATYDEARETLKHVGVDASGRVELDD 75  baker's yeast
19173149   4 QEEKEWEkvqkKTFTKWVNEKLIRgGQKEIGDLFTDLCDGVKLAQLLMVLQKD-AVEHNPTPYTRIQKMENVERILSFIK 82  Encephalitozoon cun...
19115207   1 MQANQWQsvqnRTFTKWFNTKLSSrDLPSVFDLRKDLSDGILLIQLLEIIGDENLGRYNRNPRMRVHRLENVNKALEYIK 80  fission yeast
19113081   1 MLALKLQ----KKYPELTNEEILT-LTDQFNKLDVDGKGYLDQPTTIKAFEDSKKGSYDEVREAIREVNVDSSGRVEPED 75  fission yeast
462098    76 YVGlvaklresktgaapQTTFNVAPNStpivstAATGLQHKGKGtqakIIVAGSQTGTTHTINEEErrEFTKHINSVLAG 155 baker's yeast
19173149  83 GKR--------------VKLINIGPQD------IVDGNPKLILG----LIWSLISRLAIAKTAEAG--ELSIRNELLRWC 136 Encephalitozoon cun...
19115207  81 SKGm--------------pLTNIGPAD------IVDGNLKLILG----LIWTLILRFTIADINEEG---LTAKEGLLLWC 133 fission yeast
19113081  76 FVG----------------IFNVLKKG-------VEGTEVK-KGr---ITIKGSSSSVSHTINEEErrEFIKHINSVLAG 128 fission yeast
462098   156 DQDIGDLLPfPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIG-CVVVNV 234 baker's yeast
19173149 137 KEVTSGYKN--VNIADFSRSWRDGLAFNAIIHRFRPD-LVPNFHDLQASEKAYNLNQAFKVAEKFLGIKRLLDvEDIVEV 213 Encephalitozoon cun...
19115207 134 QRKTANYHP-EVDVQDFTRSWTNGLAFCALIHQHRPDLLDYNKLD--KKNHRANMQLAFDIAQKSIGIPRLIEvEDVCDV 210 fission yeast
19113081 129 DPDVGSRVPiNTETFEFFDQCKDGLILSKLINDSVPDTIDERVLNKQRNNKPLDNFKCIENNNVVINSAKAMGgISITNI 208 fission yeast
462098   235 HSEDiiEgREHLILgLIWQIIRRGLLSKIDIKLHpELYRLLEDDETLEQfLRLPPEQILLRWFN-YHLKQANWNrrVTNF 313 baker's yeast
19173149 214 SIPD--E-KSIMTY-VSGYYKKFREYEKEKSALS-RVKGVLEAVDWSIQ-ARNLYEIKARSLLSlIKGLDGQRK----EV 283 Encephalitozoon cun...
19115207 211 DRPD--E-RSIMTY-VAEYFHAFSTLDKVETAAR-RVERFTEVLMSTHD-MKIDYESRMKRLLGsIARMQEYWH--TVQF 282 fission yeast
19113081 209 GAGDilEgREHLILgLVWQIIRRGLLGKIDITLHpELYRLLEEDETLDQfLRLPPEKILLRWFN-YHLKAANWPrtVSNF 287 fission yeast
462098   314 SKDVSDGENYTILLNQLDpALCSKAPL-QTTDLMERAEQVLQNAEKLDCRKYLTPsslvAGNPKLNLAFVAHLFNTHPG- 391 baker's yeast
19173149 284 CKLIRSLNKAFDLLLEMN----SRAVH-ESAELHSLFGSINAVHSLYRIKKYSPP---------EDVSLEKFLFPPLQP- 348 Encephalitozoon cun...
19115207 283 ENNYTDVKSHSNNFAKFK-ATEKREWVkEKIDLESLLGTIQTNLKTYQLRKYEPP----AGLKIVDLERQWKDFLSEEAn 357 fission yeast
19113081 288 SKDVSDGENYTVLLNQLApELCSRAPL-QTTDVLQRAEQVLQNAEKLDCRKYLTPtamvAGNPKLNLAFVAHLFNTHPG- 365 fission yeast
462098   392 LEPIQEEEKPEIEEFDAEGEREARVFTLWLNSLDVDPPVISLFDDLKDGLILLQAYEKVM-PGAVDFKHVNKRP----AS 466 baker's yeast
19173149 349 QKIVESIGIKKLFDPSFQSEFEALNRTFELFKHMLS-----KGGDVREQMQVTSELSNKLmEMTFTHPLAKTQK------ 417 Encephalitozoon cun...
19115207 358 QSKLINTHMREIKES-MRIAFADRANSFSKMLSTISNEITNLQGDWRDQLDHVEFLQEHLgPLEVELASVKVLYdncfQA 436 fission yeast
19113081 366 LEPLNEEEKPEIEPFDAEGEREARVFTLWLNSLDVTPSIHDFFNNLRDGLILLQAYDKIT-PNTVNWKKVNKAP----AS 440 fission yeast
462098   467 GAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKlLTLGLVWQLMRRNISITMKTLSSSGRDMSDSQILKWAQD 546 baker's yeast
19173149 418 ----------------------EGFKGIAMKKLETLKKIQ-DKKTKEEKVLESATALFNTVLKKDECGISPTDLCWCLGQ 474 Encephalitozoon cun...
19115207 437 GIEENDYTMFSYEDLEHEFGITANIIANKIKYLENELLER-EKRTLSKQELDGITKVFRHFEKKKSNMLNEVEFYAALAS 515 fission yeast
19113081 441 GDEMMRFKAVENCNYAVDLGKNQGFSLVGIQGADITDGSRtLTLALVWQMMRMNITKTLHSLSRGGKTLSDSDMVAWANS 520 fission yeast
462098   547 QVTKGGKNSTIRSFKDQALSN-AHFLLDVLNGIAPGYVDYDLVTPGNTEE--ERYANAR-LAIS--IARKLG--ALIWLV 618 baker's yeast
19173149 475 LGLSVD--EGMVPFGNPDGRVsLEDYLLIVKETHSTLCDSSDLKRAFKMFttDDILDLRsLGIEskDLRSVY-------- 544 Encephalitozoon cun...
19115207 516 LGLVYDTEEGTALFHRAANSEeGVTYERFTEIVMEELEDRDSARQVLYAF--CDVADGKsYVTSddLLRSQVrpNIVKFL 593 fission yeast
19113081 521 MAAKGGKGSQIRSFRDPSIST-GVFVLDVLHGIKSEYVDYNLVTDGSTEE--LAIQNAR-LAIS--IARKLG--AVIFIL 592 fission yeast
462098   619 PEDINEVRARL-IITFIASLMTL 640 baker's yeast
19173149 545 --HFNGEKPSLdVNKFFESFIED 565 Encephalitozoon cuniculi
19115207 594 ECNMNKHSEGLdYLTWIKQLLAE 616 fission yeast
19113081 593 PEDIVAVRPRL-VLHFIGSLMAV 614 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap