Conserved Protein Domain Family
COG5076

?
COG5076: COG5076 
Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription]
Statistics
?
PSSM-Id: 227408
View PSSM: COG5076
Aligned: 21 rows
Threshold Bit Score: 126.073
Threshold Setting Gi: 417373
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
464802    282 ISISKETLSKLKTNNVEEiMGNWNKIYHSFEYDKETmIKRLKLEESDKMIEKGKKKRSRSDLEAATDEqDRENTnDEPDT 361  baker's yeast
19173481      -------------------------------------------------------------------------------- Encephalitozoon c...
19074685  585 llelsgpgdpsgigegfsfrkirlkrgnevenrkiinehqsrykeeidriwskqlaslssveeipfdesflarrhreerk 664  Encephalitozoon c...
19114532   70 LEKEQKGDNQETDYSSQYlHPTPPYTNFDDESPSSPtHPSVSNITVDGDSKKHSLQLQEEEKSSESLDsHTHPPkRVRNE 149  fission yeast
19113148  122 LEASLAEEEERKKGDAKKsEATGRQLFDDDDFDESDaEDSSKATITLDLQKDKSLRKSIIDLKSVDIDdMDTSGfAAIES 201  fission yeast
6320132     1 -----------MSRTNMDtRHAHSALLAAPQSATANsRSSNSSSESSSNKNNINVGVGDDSGNVSAVSiDDGPHfRDIFH 69   baker's yeast
1723670   115 KHYPEVTYPSLGRIP-----EIFAESMQPSDLSSNP--INTQENDEKAGLN-PEMKMAFAKLDSSIT--ERKP----TN- 179  baker's yeast
401643     40 APLNPKSELFLDDWHIPKfNRFISFTLDVLIDKYKDiFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSrDYEYEdGPSNF 119  baker's yeast
12230583  123 EKYPQLVYPDLGPLPDEPgYEEFQQKLREKAEEVAR--ANAARAESSSSMNSTEAARRLRKTRTSVKR-ESEPG-TDTNN 198  baker's yeast
5921175     1 -MTDITPVQNDVDVNGNNvNDDVSSNLKRPIDQGDPsNGLAEEENPANNQLHLKKARLDGDALTSSPAgLAENGiEGATL 79   baker's yeast
464802    362 NQKLPTPEGSTFSDTGNKRPKQSNLDLTVNLGIENLSLKHLLSSIQQKKSQLgisdye------------------lkhl 423  baker's yeast
19173481    1 ----------------------MGEKDEMKHSLFGVLRMNGKKKCNVFMID----------------------------- 29   Encephalitozoon c...
19074685  665 nadllsettmlseethltirrtygegstsyvevervsdprvikaylkarkkkiseerkgvltcgncgqvghmktnkacpk 744  Encephalitozoon c...
19114532  150 DDSLTFSKTSPVSPSSLKDGASNTVTNDASNKIKSEASESASPSALQALDSTaagsske----------------hssph 213  fission yeast
19113148  202 NKALSNISFNYVYYTLENDSENINEVKKFEDEEDTSTPNTSSFQNNSSSLDLsdnlsyllqylegnrskinatdadvkql 281  fission yeast
6320132    70 YGHEENYKLASSGITNLNSSSHAHQTLSPISISNASTPESFPEHPLGLERET---------------------------- 121  baker's yeast
1723670   180 -QDYRMQQK--NSP---AFP--THSASITPQPLASPTPVVNYANITSAHPkt---------------------------- 223  baker's yeast
401643    120 LLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVk--------------------------- 172  baker's yeast
12230583  199 DEDYEATDMDIDNPKDADFPDLIRKPLININPYTR-KPLRDNRSTTPSHSGTpqplgprh-----------------rqv 260  baker's yeast
5921175    80 AANGENGYNATGSGAEDEQQGLKKEEGGQGTKQEDLDENSKQELPMEVPKEPap-------------------------- 133  baker's yeast
464802    424 imDVRKNRSKWTSDERIGQEELYEACEKVVLELRNYTEHSTPFLNKVSKREAPNYHQIIKKSMDLNTVLKKLKSFQYDSK 503  baker's yeast
19173481   30 -----LISTSEEKRMFLDRVFFLPQRLTRILAAIKSFEQSKVFLSRPLKKNMPRSHKMIGIPMDLGIVQKKIG--KYKSF 102  Encephalitozoon c...
19074685  745 faSATKMTKKKIEAEKRKARVYLQEVMIDLLGQFFQIPYSVAFHRPVSTKKFPDYPLIVSDPIDLTTIKTKARHNKYRKF 824  Encephalitozoon c...
19114532  214 deTVKKEENDKDQYPPMTKEQHKYIHAMLRQLRRGRDSIPFRAPVDPVKQNIPDYPTIIKNPIDLGTMQKKFSSGVYSSA 293  fission yeast
19113148  282 lsDVKKNKSKWANDQRIGQEELYEAAEKVVLELRSYTEHSLAFLTKVSKRDAPDYYTVIKEPMDLGTILRNLKNLHYNSK 361  fission yeast
6320132   122 ----EPALEAEMEAEELPPHQSKYLLSSIKATKRLKDARPFLKPVDPIALNIPHYFNYVQTPMDLSLIETKLQGNVYHSV 197  baker's yeast
1723670   224 ---hVRRGRPPVIDLPYVLRIKNILKMMRREVDQNNKTLTLCFEKLPDRNEEPTYYSVITDPICLMDIRKKVKSRKYRNF 300  baker's yeast
401643    173 --AKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKI 250  baker's yeast
12230583  261 srtqVKRGRPPIIDLPYIQRMKNVMKVLKKEVLDSGIGLTDLFERLPDRHRDANYYIMIANPISLQDINKKVKTRRYKTF 340  baker's yeast
5921175   134 apP-PEPDMNNLPQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVP 212  baker's yeast
464802    504 QEFVDDIMLIWKNCLTYNsDPSHFLRGHAIAMQKKSLQLIRMIPNITIRNRADLEK-EIEDMekdk--dyelDEEEEVAG 580  baker's yeast
19173481  103 EEFKADLDLIWDNCLRFD-QEKHHRDCATKMREVVSTFEIEVVPVCMDPGFPMNSSfWEGGEn---------QGPCIKHA 172  Encephalitozoon c...
19074685  825 SEFLEDLELMRSNCCKYN-GEDHSLTRIADNIVEAGYKRYNERMEEILEAERVLNG-SFDE------------------- 883  Encephalitozoon c...
19114532  294 QHFIDDMNLMFSNCFLYN-GTESPVGVMGKNLQATFERQLKQLPSAYVTSYSRPGR-RPRSMtapkggartrRQAAMYSN 371  fission yeast
19113148  362 KEFVHDLMLIWSNCFLYNsHPDHPLRVHAQFMKDKSLELINLIPDIVIQSRKDYDD-SLIEAelesdeestaETSKHVTS 440  fission yeast
6320132   198 EQVTSDFKTMVDNCLNFN-GPESSISSMAKRIQKYFEKKLSAMPPRVLPASALKKTsRNRKKnedmdsplviRRSVSTTN 276  baker's yeast
1723670   301 HTFEEDFQLMLTNFKLYY-SQDQSNIIRAQLLEKNFNRLVR-IELSKPDEDYLPEG-ELRYP----------LDDVEIND 367  baker's yeast
401643    251 YDFIIDMLLVFQNAHIFN-DPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGE-INLEFdkf-----efENYLAIGG 323  baker's yeast
12230583  341 QEFQNDFNLMLTNFRISH-RGDPESIKISNILEKTFTSLAR-FELSKPDRSFIPEG-ELRYP----------LDEVIVNN 407  baker's yeast
5921175   213 EQITEDFNLMVNNSIKFN-GPNAGISQMARNIQASFEKHMLNMPAKDAPPVIAKGR----------------RSSAQEDA 275  baker's yeast
464802    581 SgrkGLNMGAHMLAKENGKVSEKDSSKTVKDEAPTNDDKLT-SVIPEGEKE-KDKTASSTVTVHENVNKNEIKENGKNEE 658  baker's yeast
19173481  173 IrkmAARVLLSTGYGFASRTALWVLCDAFQRKMLEIIKEVVaERAGG--------------------------------- 219  Encephalitozoon c...
19074685      -------------------------------------------------------------------------------- Encephalitozoon c...
19114532  372 Ss--SGIRETMYDLKPHRRKDAAEMKFCQSVLKELLKKQHEaYAYPFYKPVnPTACGCPDYFKVIKHPMDLGTMQNKLNH 449  fission yeast
19113148  441 KktsSRGGQTQQAVEVHTDANSPEENNTPVTKKEVETSKPP-AVSGSTPPVnEAAVIESSNTLEKEPLSDVATEYWKIKT 519  fission yeast
6320132   277 DnigESGNREGVSGGRPKRTIHPPKSKDLFDIYENSKPKSKtLQKKFRTCLkILKVLMSKKNSDINFPFLQPVDPIALNL 356  baker's yeast
1723670   368 E---KYQIGDWVLLHNPNDINKPIVGQIFRLWSTTDGNKWL-NACWYFRPE-QTVHRVDRLFYKNEVMKTGQYRDHPIQD 442  baker's yeast
401643    324 Gg--PAAAGALAISALDNDIEPESNREDLIDQADYDFNHFEgLGNGYNRSLlTEDYLLNPNNFKKLIAIPETVQSEVKNE 401  baker's yeast
12230583  408 I---SYHVGDWALLRNQNDPQKPIVGQIFRLWKTPDGKQWL-NACWYYRPE-QTVHRVDRLFYKNEVMKTGQYRDHLVSN 482  baker's yeast
5921175   276 P---IVIRRAQTHNGRPKRTIHPPKSKDIYPYESKKPKSKR-LQQAMKFCQsVLKELMAKKHASYNYPFLEPVDPVSMNL 351  baker's yeast
464802    659 QDMVEESSKTEDSSKDADAAKK 680  baker's yeast
19173481      ---------------------- Encephalitozoon cuniculi
19074685      ---------------------- Encephalitozoon cuniculi
19114532  450 NEYASMKAFEADMVLMFKNCYK 471  fission yeast
19113148  520 KDIRESHILNNRRILKSLQFIE 541  fission yeast
6320132   357 PNYFDVVKNPMDLGTISNNLMN 378  baker's yeast
1723670   443 IKGKCYVIHFTRFQRGDPSTKV 464  baker's yeast
401643    402 RSTTSDIEKTNSLESEHLKIPK 423  baker's yeast
12230583  483 LVGKCYVIHFTRYQRGNPDMKL 504  baker's yeast
5921175   352 PTYFDYVKEPMDLGTIAKKLND 373  baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap