Conserved Protein Domain Family
COG5134

?
COG5134: COG5134 
Uncharacterized conserved protein [Function unknown]
Statistics
?
PSSM-Id: 227463
View PSSM: COG5134
Aligned: 3 rows
Threshold Bit Score: 371.335
Threshold Setting Gi: 19112526
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19112526   1 MGKYIPPEG------PNAKRKFDKLRN------VIRFEMPFPVWCNNCENIIQQGTRFNAVKKEIG--SYYTTKIWSFSL 66  fission yeast
19173383   2 HHTPECTGInrvlaqPLVMNRENKRKGarprglSTRLATPFTIRCLSCGSYIYKNKRHNAVREIAQdkDYLGVESYRFHI 81  Encephalitozoon cun...
140962     7 INKYYPPDYnpleaeKLSRKMAKKLKTmnkshaSIRLMTPFSMRCLECNEYIPKSRKFNGKKELLKekYLDSIKIYRLTI 86  baker's yeast
19112526  67 KCHLCSNPIDVHTDPKNTEYIVASGGRRKIEPQDINERPAKAENDEKVP-SDAIEALETQLTQQKSEKHNSSVINFIYEK 145 fission yeast
19173383  82 ICTGCGRALCIRTDPKNGVYVTESGCIR-IDEEVTKQDEEKDLSVKLRKeSDMKDEISKLRVQTSHVDSSSSAFNSSDKL 160 Encephalitozoon cun...
140962    87 SCPRCANSIAFRTDPGNSDYVMEVGGVRNYVPQKPNDDLNAKTAVESIDeTLQRLVREKEMEQNEKMGIKEQADDKMDLL 166 baker's yeast
19112526 146 NERLWSDPFVSSQRLRKQFRERKKIEKKQEAKDLSLKNRAALDIDILPpSSSDKDKALLLLDNELGKNKFIRKLDYRRTl 225 fission yeast
19173383 161 GK------------------------------------------------------------------------------ 162 Encephalitozoon cun...
140962   167 EKRLAKIQQEQEDDEELENLRKKNLEMSQRAEMINRSKHAQQEKAVTT-DDLDNLVDQVFDNHRQRTNKPGNNNDEKRT- 244 baker's yeast
19112526 226 mPSSRTFSTFAKFAETSFAKKDPFARKFVPSEKLR 260 fission yeast
19173383     -----------------------------------     Encephalitozoon cuniculi
140962   245 -PLFNPTSTKGKIQKKSSVRTNPLGIVIKRGKSLK 278 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap