Conserved Protein Domain Family
COG5222

?
COG5222: COG5222 
Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Statistics
?
PSSM-Id: 227547
View PSSM: COG5222
Aligned: 3 rows
Threshold Bit Score: 436.1
Threshold Setting Gi: 19173154
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19113314   1 MSGVIYYKFKSQKDPSRITFDGTiGMSVFDVKREIIMQKKLGNGLDFDLLLYNANSNEEYDDDTFIIPRSTSVIVRRVPA 80  fission yeast
19173154   1 MTSVINYRFRSNKNFSRISFQGT-GLPLWELKYEIINQRKMVS-KDFDLLFFDGETNEEINDEYQVVSMNSHVIVSRIPL 78  Encephalitozoon cun...
549683     1 MSSTIFYRFKSQRNTSRILFDGT-GLTVFDLKREIIQENKLGDGTDFQLKIYNPDTEEEYDDDAFVIPRSTSVIVKRSPA 79  baker's yeast
19113314  81 QKSgKGTAARYVS--GAPKTTGARSDSVKRPVpMLQKKAPITSGESNINkspSSSEDAAIQQMFQVSSDQWRETQDKMAS 158 fission yeast
19173154  79 WMS--------KG-----------GYNVKEKR-------------LESQ----------------------------GS- 97  Encephalitozoon cun...
549683    80 IKS-FSVHSRLKGnvGAAALGNATRYVTGRPR-VLQKRQHTATTTANVS---GTTEEERIASMFATQENQWEQTQEEMSA 154 baker's yeast
19113314 159 ATPIYKPNQR-RIAASVPDKPPPPGYICYRCGQKGHWIQACPTNADPNYDGKpRVKRTTGIPRSFLKNVER------PAE 231 fission yeast
19173154  98 --------HH---GSQKHNKAVPESYVCFRCGQKGHYIQNCHTNQDKAFDIL-RIRKPSGIPKDFLVPVYG------ENV 159 Encephalitozoon cun...
549683   155 ATPVFFKSQTnKNSAQENEGPPPPGYMCYRCGGRDHWIKNCPTNSDPNFEGK-RIRRTTGIPKKFLKSIEIdpetmtPEE 233 baker's yeast
19113314 232 GDAANIMINAEGDYVVVQPDVASWETYQSRKAALTAN-D--VY-KMQPPNIS--LACTLCKKLARNACRT-PCCDKLFCE 304 fission yeast
19173154 160 PSNAAMLVTPEGGYVKAQPQVQEWKKYKQRTKAVAEIpDq--------------LKCPSCHCLLINPMKT--SCGHTLCD 223 Encephalitozoon cun...
549683   234 MAQRKIMITDEGKFVVQVEDKQSWEDYQRKRENRQIDgDetIWrKGHFKDLPddLKCPLTGGLLRQPVKTsKCCNIDFSK 313 baker's yeast
19113314 305 ECIQTALLDSDFECPNCHRKDVLLDTLNPDYQKQREIEAVVKsvlgsnsKNSDKVGTSDDNNTPMSEKRKREDddangPN 384 fission yeast
19173154 224 QCIG-----MDKKCYVCSR---VIEGFTQDIDMKLEVEKALE--------QRK--------------------------- 260 Encephalitozoon cun...
549683   314 EALENALVESDFVCPNCETRDILLDSLVPDQDKEKEVETFLK-------KQEELHGSSKDGNQPETKKMKLMD-----PT 381 baker's yeast
19113314 385 kfaarSSAVFSKATAEPAFKSAMAIPdMPSMPHVQGFPaPFPpfMMPgLPQMPPMMMnaIAgqvyhnnrNPPRTNSRPSN 464 fission yeast
19173154     -------------------------------------------------------------------------------- Encephalitozoon cun...
549683   382 -----GTAGLNNNTSLPTSVNNGGTP-VPPVPLPFGIP-PFP--MFP-MPFMPPTAT--IT--------NPHQADASPKK 441 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap