Conserved Protein Domain Family
MDN1

?
COG5271: MDN1 
Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 227596
View PSSM: COG5271
Aligned: 3 rows
Threshold Bit Score: 4222.09
Threshold Setting Gi: 19173514
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6323135    89 IEKLASIITIFpvamPLIEDYLDKENdhFItilqnPSTqkdsdmfkILLayyRLLYHnkevfarfiQPdilYQLVDlltk 168  baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870    1 MDVLIEWVAIY----PQIYDILEHIN--YV-----PSN--------TLQ---RLRLH---------QP---WSKID---- 42   fission yeast
6323135   169 eqenqvviflaLKVLSLYLdmgektLNDMLDTyIKSRdsllghFEGDSgIDYSFLELNEAKRCANFSKLPSVpecFTIEK 248  baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870   43 -----------YDVWFLYA------SDEIRET-CKVK------YYGET-KTYGEVFVLENERISQLHRLFVS---WTVSE 94   fission yeast
6323135   249 KSSYF--IIEPQDLS-TKVASICGVIVPKVHtihdkVFYPLTFVPTHKTVSSLRQLGRKIQNSTPIMLIGKAGSGKTFLI 325  baker's yeast
19173514    1 -------------------------MKFKKH------KKDEIRVGFLENLDRLAKEAVDLKIAVDVYGEVGRTSLISKLH 49   Encephalitozoon c...
19075870   95 RAEHLknLLFDAGLSnLPLVELGGNVFFNSH-----VPLPCSLVLTKSTQENLNRITPYLVQKRPILLAGPEGIGKKFLI 169  fission yeast
6323135   326 NELSKYMGchDSIVKIHLGEQTDAKLLIGTYTSgDKPGTFEWRAGVLATAVKEGRWVLIEDIDKAPTDVLSILLSLLEKR 405  baker's yeast
19173514   50 SELCDEGG---RLVEIDSREITDARVLGGFYAV--KEGDVEYMKGLLIESMVSGDWILFKRIDKN-HGLLQYLFTVIKYR 123  Encephalitozoon c...
19075870  170 TQIAAKLG--QQIIRIHLSDSTDPKMLIGTYTS-PKPGEFEWQPGVLTQAVITGKWILFTNIEHAPSEVLSVLLPLLEKR 246  fission yeast
6323135   406 ELTIPSRGETVKAANGFQLISTvrinedhqkdSSNKIYnlnMIGMRIWNVIELE-EPSEedLTHILAQKFPILTNLIPKL 484  baker's yeast
19173514  124 RLLG-NDGEEVLAHDNFRIFFT----------------------------------SDD-------RFDMDDVVFVGPLS 161  Encephalitozoon c...
19075870  247 QLVIPSRGETIYAKGSFQMFAT----------SSMKTK---ILGQRLWQILDLTyQPDE--CVEVVSTLYPVLSIICPTL 311  fission yeast
6323135   485 IDSYKNVKSIYMNTKFISLNKgaHTRVVSVRDLIKLCERLDILFKNNGINKPDQLIQSSVYDSIFSEAADCFAGAIGEFK 564  baker's yeast
19173514  162 FVFEEAIEMFEAQCTRRLLTK-----VFRDISADWKVC--TKDKEGECRKSCPKRICGNNEWCLSEGSVVCG----PHFR 230  Encephalitozoon c...
19075870  312 YSVYKDIFDLFSQRSFLATSK--IYRRLCLRDFYKFIKRVAFLYHKFMIPSDHVVISQELQDAVFKEAIDMFGAFIPSRD 389  fission yeast
6323135   565 ALEPIIQAIGESLDIASSRiSLFLTQHVPTLENLDDSIKIGRAVLLKEKLNIQKKSMNStlFAFTNHSLRLMEQISVCIQ 644  baker's yeast
19173514  231 SLLKIKKRMGSSNGAGVEE-RVRAYQSVCNVL-LKHESDSLRCALTLTEIPSISLHGIG--FAKTSCVEWGLFNLLWNIR 306  Encephalitozoon c...
19075870  390 GFDLVVRNVAIELNIPPEK-ALQLRYSIPVFQNLEHNINIGRCSLKKLST-IRSCSTNS--YAFTSSSLGLLEQLAAGVQ 465  fission yeast
6323135   645 MTEPVLLVGETGTGKTTVVQQLAKMLAKKLTVINVSQQTETGDLLGGYKPVNSKTVAVPIQENFETLFNATFSLKKNEKF 724  baker's yeast
19173514  307 NNDHTLLIGDTGVGKTSMIQYLSLKSHFFLGTQAKLRIVNMSADFDGTDLIGG--------------Y-GTLDMNKAIEK 371  Encephalitozoon c...
19075870  466 TNEPLLLVGETGTGKTTTIQLLAGLLGQKVTVINMSQQTESSDMLGGYKPINASTLGLPLHERFIDIFEQTFSSKKNAKF 545  fission yeast
6323135   725 HKMLHRCFNKNQWKNVVKLWNEAYKMAQSILkiTNtENENENAKKKKRRLNTheKKLLLDKWADFNDSVKKFEAQSSSIE 804  baker's yeast
19173514  372 ICNEQRVSVPVCYGNKEKLEWLRNRISSKAG--DG---------------------------TDLEAVTKRIDGLLKLLE 422  Encephalitozoon c...
19075870  546 ISMASTSARRFRWKTCLKIWKEACKLSKTVL--DG-QQPLPNPQKRQKRLSN--QVELRNQWAKFEKEVEDFEKVLTGGS 620  fission yeast
6323135   805 NSFVFNFVEGSLVKTIRAGEWLLLDEVNLATADTLESISDLLTEPDSrSILLSEKGDAEPIKAHPDFRIFACMNPATDVG 884  baker's yeast
19173514  423 KRAHFVYKRGILTECMVNGEWLLLDEINLSSEETLNLIDGVLGKKEI---FLYESGDLRPLRIHPGFLLFGCMNPGGDFG 499  Encephalitozoon c...
19075870  621 NGFMFSFVEGALVKAVRSGHWVLLDEINLASLETLEPIGQLLSSYES-GILLSERGDITPITPHKNFRLFGCMNPSTDVG 699  fission yeast
6323135   885 KRDLPMGIRSRFTEIYVHSPERDITDLLSIIDKYIGKYSVSDEWVGNDIAELYLEAKKLSDNNTIVDGSNQKPHFSIRTL 964  baker's yeast
19173514  500 KKKYEG---IEFNAVHIYDFSTSLKDINLVVHSVL-RYEISEERKS-KIGEFFLELKSKVLGKELSN--VVEPLVSGRSL 572  Encephalitozoon c...
19075870  700 KRELEPSFRSRFTEIYVHSPDQNLDDLLSIIQKYIGSLCIGNEHVIREVAELYQVAKSLSLDGSLVDGAGQRPHYTVRTL 779  fission yeast
6323135   965 TRTLLYVTDIIHIYGLRRSLYDGFCMSFLTLLDQKSEAILKPVIEKFTLGRLKN--VKSIMSQTPPSPGPD-YVQFKHYW 1041 baker's yeast
19173514  573 VRVLNFIRNSGERE-FCKSVYEAFDLFVFTQLDFVSRSIAVSLLSKYFAVLPES-----TEKTK---------------V 631  Encephalitozoon c...
19075870  780 SRTLSYVTEIAPIYGLRRSLYEGFCMSFLTLLDHTSESLLYNHVVRFTLGELNRdqQNAILKQIPKVPDHSsYIAFCHYW 859  fission yeast
6323135  1042 MKKGPNTIQEQAHYIITPFVEKNMMNLVRATSGKRFPVLIQGPTSSGKTSMIKYLADITGHKFVRINNHEHTDLQEYLGT 1121 baker's yeast
19173514  632 KHG----------FVLTPRIQT-YLRTMRQAILSNCPLLLQGDTSTGKTSMILFLSREMCRRVIRINNHEHTEAADYIGS 700  Encephalitozoon c...
19075870  860 LRRGSFPVEEQEHYIITPFVQKNLLNIARACSTRMFPILIQGPTSSGKTSMIEYVAKKTGHKFVRINNHEHTDLQEYIGT 939  fission yeast
6323135  1122 YVTDDTGKLSFKEGVLVEALRKGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVVHPHPDFLLFATQNPPGIYG 1201 baker's yeast
19173514  701 FASTSDG-IEFKEGALVGAMRRGDWVILDELNLACSDVLEVLNRLLDDNRQIYIPETDEVVVPHENFRIFATQN--IGYG 777  Encephalitozoon c...
19075870  940 YVTDDNGSLSFREGVLVEALRNGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQVLVKPHPEFMLFATQNPPGVYA 1019 fission yeast
6323135  1202 GRKILSRAFRNRFLELHFDDIPQDELEIILRERCQIAPSYAKKIVEVYRQLSIERSASRLFEQKNSFATLRDLFRWALRD 1281 baker's yeast
19173514  778 GRKGLSKAFRNRFVEMFFCENGEDEILEILHGGSELPKSFCKKMVEVYSGLRSRRSIN-------ALITLRDLFKWSGRI 850  Encephalitozoon c...
19075870 1020 GRKHLSRAFRNRFLEIHFDDIPENELETILHKRCKIAPSYAAKIVQVFRELSLRRQTTRIFEQKNSFATLRDLFRWAFRE 1099 fission yeast
6323135  1282 AVGYEQLAASGYMLLAERCRTPQEKVTVKKTLEKVMKVKLDMDQYY--ASLE---DKSLEA--IGSVTWTKGMRRLSVLV 1354 baker's yeast
19173514  851 PTCMDEVCFLGMSMIYERQRELEDRVRVGQVFSESFGEASVERYKK---------MIAGKE---------E-KCEGERMA 911  Encephalitozoon c...
19075870 1100 AVGYQQLAENGYMLLAERARDQKDKLAVQEVIEKVMKVKIDTDGIYnlDSMEifqDMSLKEgpLSKVVWTRPMIRLFCLV 1179 fission yeast
6323135  1355 SSCLKNKEPVLLVGETGCGKTTICQLLAQFMGRELITLNAHQNTETGDILGAQRPVRNRSEIQYKLIKSLKTALNIANDQ 1434 baker's yeast
19173514  912 GKCDVTLREAFLVIEK---LYAGNFVLTDTFRRLINLMILAWESK--------EPILIVGETGIGKTKACDIASSVFKTR 980  Encephalitozoon c...
19075870 1180 WRCLLAKEPVLLVGDTGCGKTTVCQILAECLHKELHIINAHQDTENGDIIGAQRPVRNRSAVNYSLHSQLCEKFNVQESL 1259 fission yeast
6323135  1435 D--VDLKELLQLYSKSD-NKNIAEDVQLEIQKLRDslnvLFEWSDGPLIQAMRTGNFFLLDEISLADDSVLERLNSVLEP 1511 baker's yeast
19173514  981 L--ITL-SMHRGIESSD------FIG-SFVFENSK-----IVWKDGPLVKAMKCGDAFLIDEINLAEDSVLERLNSVLES 1045 Encephalitozoon c...
19075870 1260 DsiDDLIEKFEKLSSSEkNDNLSNLIERQIIKYRS----LFEWHDGALVTAMKQGDFFLLDEISLADDSVLERLNSVLEL 1335 fission yeast
6323135  1512 ERSLLLAEQGSSDSLVTASENFQFFATMNPGGDYGKKELSPALRNRFTEIWVPSMEDFNDVNMIVSSRLLEDLKDLANPI 1591 baker's yeast
19173514 1046 QRTLYITETG---EEVVAHDGFRILATMNPGGDFGKRELSPALRNRFTEMYFEVSSDEAPLIFDYLVDKRFGEVDIPKKS 1122 Encephalitozoon c...
19075870 1336 SRTLTLVEHSNAAVSLTAKDGFAFFATMNPGGDYGKKELSPALRNRFTEIWVPPMVDTEDILKIVEGKLHNNKIELARPL 1415 fission yeast
6323135  1592 VKFSEWFGKKLgggnATSGVISLRDILAWVEFINKVfpKIQNKSTALIQGASMVFIDALGTNNTAYLAENENDLKSLRTE 1671 baker's yeast
19173514 1123 TETFKYLARSL------N--VSIRKLELIVEFIYRR---------------------YMGEFSGVACAEAGLDVES---- 1169 Encephalitozoon c...
19075870 1416 VEYAKWHANEY----LYTDVISIRDVLSAVEFINAC--EILDLNLVLFNAVSMVFIDALGSFTTFSLSNNLASLHAERQR 1489 fission yeast
6323135  1672 CIIQLLKLCGDDLELQQIETNEIIVTQDELQVGMFKIPRFPDAQS-SSFNLTAPTTASNLVRVVRAMQVHKPILLEGSPG 1750 baker's yeast
19173514 1170 --VWEEALEVAGIKGIEADVNARYFEDERMFG---VLPYLVEHHSsSSFDFESPTSTVNLRRILRAMGLGRGTMLEGDPG 1244 Encephalitozoon c...
19075870 1490 CFAKLNELAGSNIMASKSADISIKFSDSSFFIGDFGIPLGDSVESdSTYSLHTDTTLMNASKVLRALQVLKPILLEGSPG 1569 fission yeast
6323135  1751 VGKTSLITALANITGNKLTRINLSEQTDLVDLFGADAPGE--RSGEFLWHDAPFLRAMKKGEWVLLDEMNLASQSVLEGL 1828 baker's yeast
19173514 1245 IGKTSIIQGLARKMGKKCIRINLSEQTELCDLVGSYLPVD----GEIRFMESELLHSLRDGGWIILDEINLCTQSVIEGL 1320 Encephalitozoon c...
19075870 1570 VGKTSLITALARETGHQLVRINLSDQTDLMDLFGSDVPVEggEGGQFAWRDAPFLAAMRNGHWVLLDELNLASQSVLEGL 1649 fission yeast
6323135  1829 NACLDHRGEAYIPELDISFSCHPNFLVFAAQNPQYQGGGRKGLPKSFVNRFSVVFIDMLTSDDLLLIAKHLYPSIEPDII 1908 baker's yeast
19173514 1321 NSVLDYRRKLFIPEV--TVDVHEDTRIFATLNPCDSRNGRKMLPKSFLDRFVRIKMDGYTTDDITHILNKMFP------- 1391 Encephalitozoon c...
19075870 1650 NACLDHRNEAYIPELDKVFKAHPNFRVFAAQNPQHQGGGRKGLPRSFINRFSVVYVEALKEKDMIEIAACNYHQVNEDWR 1729 fission yeast
6323135  1909 AKMIKLMSTLEDQVCKRKLWGNSGSPWEFNLRDTLRWLKLLNQYSICEDVDVFDFVDIIVKQRFRTISDKNKAQLLIEDI 1988 baker's yeast
19173514 1392 -------S-----------------PMIVSS-TSLRENIRMNQVGTLEDGDTSYFIDESVVR------------------ 1428 Encephalitozoon c...
19075870 1730 LKIIKFMFRLQDNIEKDISFGSFGSPWEFNLRDTLRWLQLLNDAPKYTCVSPADYLEVMVLHRMRTVEDRVRTCELFKEV 1809 fission yeast
6323135  1989 FG-KFSTKENFFKLTEDYVQINNEVALRNPHYRYPITQNLFPLECNVAVYESVLKAINNNWPLVLVGPSNSGKTETIRFL 2067 baker's yeast
19173514 1429 VG---------------------SVTVEMKERRPRLD--FVLIHSQLQGLEMIMRCIEMNIPLIISG--GVGKDSLLRFV 1483 Encephalitozoon c...
19075870 1810 FDiDYEPRTIGFSLSSQCFKVGHSLLVRDVERQKTLLDSQNILQSQLPVLESVITCINKKWPCILVGDTATGKTCILRLL 1889 fission yeast
6323135  2068 ASILGPRVDVFSMNSDIDSMDILGGYEQVDLTRQISYITEELTNIVREIISMNMKLSPNATAIMEGLNLLKYLLNNIVTP 2147 baker's yeast
19173514 1484 SSVFGQEMTLFNCHKDTDVCDLLGQYQKMQNGMFEWCDSAVVSSVKEGKMVVFAGVEFVEKSVFDRLNSLFESERTLNVY 1563 Encephalitozoon c...
19075870 1890 AAIAGAKIKEMAVNSDTDTMDLIGEYEQIDISRKAS---ELFTDLSQQLLNIVIKYR-NFDNIFRETSLYTLTTTSFKTH 1965 fission yeast
6323135  2148 -EKFQDFRNRFNRfFSHLEGHP-LLKTMSMNIEKMTEIITK-EAS--VKFEWFDGMLVKAVEKGHWLILDNANLCSPSVL 2222 baker's yeast
19173514 1564 -ERGVDTNVAVNP----LTRLVlVAKEPGMLSPALLDRCMHvELS--DRLNYIDLWKLFVKFPIDGGPVFCRDFCGLSMK 1636 Encephalitozoon c...
19075870 1966 sQAFTLLQKVVDQ-LDQLKIHEtLVHSLGDIHEKARKLLAEfSASpaGRFEWFDGYLLKAVEEGHWFVLDNANLCSPAVL 2044 fission yeast
6323135  2223 DRLNSLLEIDGSLLINECSQEDGQPRVLKPHPNFRLFLTMDPKYGELSRAMRNRGVEIY-----IDELHSRSTAFDR--- 2294 baker's yeast
19173514 1637 SRP-----LSFGLDLKRFRMLGIWPDFLSKHLCGVYNTLEE--R-EIDRLFRFRNKSIP-----NAKTDVELLNFYR--- 1700 Encephalitozoon c...
19075870 2045 DRLNSLLEHKGVLIVNEKTTEDGHPKTIKPHPNFRLFLTVNPVYGELSRAMRNRGVEIFllkeaLTEIDKKQMSLLEpap 2124 fission yeast
6323135  2295 LTLGFE-LGENIDFVS-IDDGIKKIKLNEPDMSIPLKHYVPSYLSRPCIFAQVHDILLLSdeePiEESLAAVIPISHLGE 2372 baker's yeast
19173514 1701 -RIELCiYMPHDDESRmKLLRSMGAMNSEARKAVAFIKSASLSVFSPFCNDEKCSLNFPR--------SSKDLKMKVIRS 1771 Encephalitozoon c...
19075870 2125 ISSAVDtLASNISYIKyVFETMGKIEIDGNYMYI--AHAIILALFSPRQLKLLRKVLLTN---P-QFSLSIKADAELLLT 2198 fission yeast
6323135  2373 VGKWANNVLNCTEYSEKKIAERLYVFITFLTDMGVLEKINNLYKPANlKFQKALGLHDKQLTEETVS--LTLNEYVLPTV 2450 baker's yeast
19173514 1772 LRDKKFSEYRKLKTIAEHLPEVRWEFLPEFDEFYFEFIERCQNDPLS-MVREGLVVEMNEFENKSLT--------AIHDV 1842 Encephalitozoon c...
19075870 2199 LKNLVQKIY-CADYFN-HMDLKASRFMDIYEYPVQLREVVGLIQTIN-DFQSVILTSHLELPETYASglLFVSAHEILDL 2275 fission yeast
6323135  2451 SKYSDKIK--SPESLYLLSSLRLLLNSLNALKLINEKSTHGKIDELTYIELSAAAFNgrhlKNIpripIFCILYNiltVM 2528 baker's yeast
19173514 1843 MKHMYKYG--K---GSVEEMVEDYERGIKEYKIKIRDVEKKMGRDYARFKESLKDLN---------------------FC 1896 Encephalitozoon c...
19075870 2276 TEEVNRLAvsTSNSTYLLKSASAVYHNVSSFKGSTP-SLWNLLNQFSKFLIEIASAN----SNI----VYKLSYD---VI 2343 fission yeast
6323135  2529 SENLKTESLFCGsNqyQYYWdllviviaaleTAVTK-DEARLRVYKELIDSWIASVKSKSDIEITpFLNIN-LE-FTDVL 2605 baker's yeast
19173514 1897 SYMCGDRLFYEG------FG------------DVFD--YYLIYMFCKWINGEGCSGK---------------CKiR--RL 1939 Encephalitozoon c...
19075870 2344 RHFLKLVVLWK--N--IYVW-----------TNVPDcDISRFYCYTKMLGEWMFTLTEKTKLLES-FLPKDsLEkFSELQ 2407 fission yeast
6323135  2606 QLSRGHSITLLWDIFRKNYPTTSNSWLAFEKLINLSEKFDKVRLLQFSESYNSIKDLMDVFRLLNDDVLNNKLSEFNLLL 2685 baker's yeast
19173514 1940 GESC----LEYRDVGIRYGDSESGSYVSYSILCLNLIRLG-LGILPHLEKIDCKGLDHEFSRYLNSLYYSRPT----DKC 2010 Encephalitozoon c...
19075870 2408 NLSTGLHMQAIWDKWHAFVPRTYDQWSLWNTVDKLLTQYVNANIPSISMETTACEVVGTSLSLLNKVLVENEVGDIYSYL 2487 fission yeast
6323135  2686 SKLEDGINELELISNKFLNK-RKHYF-----ADEFDNLIRYTFS--VDTAELIKELAPaSSLATQKLTKLITNKYNYPpi 2757 baker's yeast
19173514 2011 SLMLEGTIFDKMVHAKETSW--------------IDNLLELEEK---DLDDCLRSIFN-RKTRARVIESDASRLEIAG-- 2070 Encephalitozoon c...
19075870 2488 KILGKGVNELKSSKQVILPEnLVNLFnclasLDLLHIFIKYTTSsfFLTDDFVRFIR--VCFHSRISGNLLTLLHGIS-- 2563 fission yeast
6323135  2758 FDVLWTEKNA-KLTSFT-STIFSSQFLEDVVRKSNNLKSFSGNQIKQSISDAELLLSSTIKCSPNLLKSQMEYYKN-MLL 2834 baker's yeast
19173514 2071 ELVEFMDQEMqELPIFT-----SAACLMEYAQRKITDPECYGALSPENMDDADPSGNQILESTIVIGGHLKEKGFTgNED 2145 Encephalitozoon c...
19075870 2564 FDS--TKAVApVLTYFDfCSLTTGNILGRIALAFTSIDENANLESANIFEHARLALLQHFMDHSSLLAEDSSTKMNlILL 2641 fission yeast
6323135  2835 SWLRKVIDIHVG-GDCLK-------LTL--KELCS----LIEEKTA-----SETR-VTFAEYIFPALDLAE----SS--- 2887 baker's yeast
19173514 2146 SQVHRIVEILER----------------------L-----YKDTSA--------CdVDRNYRYFLYLVITP--------- 2181 Encephalitozoon c...
19075870 2642 QRYAVIISIFLDqGKCEKandlitkLSLpyEELAEnfvsILEACKAflvanSEFIsYTYTERFIHSLRFLKdswlSSnqq 2721 fission yeast
6323135  2888 KSLEELGEAWITFGTGLLLLFVPDSPYDPAIHDYVLYD---LFLKTKTFSQNLMKSWR--NVRKVISGDEEIFTEKLINT 2962 baker's yeast
19173514 2182 ------------FSFEMAERYFLDCSVYEFVDRVGHAR--------EMAIKDGNPVFYnvTLKYVSFEVERLYEDRIRDA 2241 Encephalitozoon c...
19075870 2722 KMLKNQGMAYIYFASGMLLVYVPDKPFDPALLPLLTVEslrHYLESLYKESQILEIAEslNSGKVNSVMRRLVSTEISNT 2801 fission yeast
6323135  2963 ISDDDAPQSprVYRTG-MSIDSLFDEWMAFLSSTMSSRQIKELVS--SYKCNSDQSDRRLEMLQQNSAHFLNRLESGYSK 3039 baker's yeast
19173514 2242 KSKLKKEPK---L------YKKILEDLKKFLILPVTNVLDLKFPQ--LYPGCQGYHPDVYTYILKNRSDCECRDWIEFAK 2310 Encephalitozoon c...
19075870 2802 PNIDSSFST--VYRSLnESIVPLYSELEFFMKSVVLNQYIFELAMrlSKESNIAVVEEAKSFVTKWKA-YIERIREAYPQ 2878 fission yeast
6323135  3040 FADLNDILAGYIYSINFGFDLLKLQKSK--DRASfQISPLWSMDPINISCAENVLSaYHELSRFFKKGDMEDT--SIEKV 3115 baker's yeast
19173514 2311 KFDRREVQNAFGGNKIKRKDVLELFFNR----IP---KEMFSNSEVCLGKVVNQMV-EDTTLMNLTRMCIENP--YIPFM 2380 Encephalitozoon c...
19075870 2879 FVDVYELILSFISFMIYGIELLMFEAKRrlDERS-QILSTLILTLVDPSSFARSLS-FDDVSNLIEQIKVLDLndSIRFE 2956 fission yeast
6323135  3116 LMYFLT--LF--KFHKRDTN-LLEIFEAALYTLYSRWSVRRFRQEQEENEKSNMFKFNDNSDDyEADFRKLFPDYEDTAL 3190 baker's yeast
19173514 2381 YFVFMF---------GREEE---GAVEDGTGMKSGTGNINVSEQIEHEDEIDDEYGEQEKVSE------SDGIDFDNDGS 2442 Encephalitozoon c...
19075870 2957 IYLFLAsrLCseKQHSSDTHsLANSFVLLANEFYIHNAKIKQKELEEIEEKNRLYRQREFNFD-KNDYLKVFINYDDEVE 3035 fission yeast
6323135  3191 VTNEKDISSP-ENLDDIYFKLADTYISVFDKDHDANFSSELKSgaiITTILSEDLKNTRIEELKSGSLSAVINTLDAETQ 3269 baker's yeast
19173514 2443 ISTASEPEEE---ECESGVDGWNDEEEEEDDDEKNEKECESEQ---NAEIDIEDEGIGSEGSLESGGEELLCSNSSEGNE 2516 Encephalitozoon c...
19075870 3036 PEVEPEVVIErKRFLQLQFAFWSLYNEIYSEKMNVIPLEQLMN---TGSYLAKKIKVKNPDMIASSGFDIVSVVLMMGVK 3112 fission yeast
6323135  3270 SFKNTEVFGN--IDFYHDFSIPEFQKAGDIIETVLKSVLKLLKQWPEHATLKELYRVSQEFLNYPIKTPLARQLQKIEQI 3347 baker's yeast
19173514 2517 SSEIEEDDVEsgGESDARSRDVEDLDSYNKPEANEYQFKEGVLNKNQTCEVAENYERYVAGKNPDDNALCAGEGSERVSG 2596 Encephalitozoon c...
19075870 3113 STNERQYWTPpvYNFYSDPNPSKAIEVRDLIKIVESRAISLIKNWPENFVLRGLKDAIDAILNLSPFSPIAEYLSKLERV 3192 fission yeast
6323135  3348 YTYLAEWEKYASSEVSLNNTVKLITDLIVSWRKLELRTWKGLFNSEDAKTRKSIGKWWFYLYESIVISNFVSEKKETAPN 3427 baker's yeast
19173514 2597 DDDDSGSGDVFESTVRIRIEDQDCTKLTNLLRIIMESKRGNRYRGDFRSGKKLNMKRLVPYIASGFRRDRIWMRR--QR- 2673 Encephalitozoon c...
19075870 3193 FHLLSEWEKLASREYSLANEMDLIKKKIIDWRKFELSNWNNLLKLEEYKLSERVYPRLYSILQFIILKPFFENSKFTKQN 3272 fission yeast
6323135  3428 ATLLVSSLNLFFSKSTLGEFNARLDLVKAFYKHIQLIGLRSSkIAGLLHNTIKFYYQFKPLIDERITNGKKSLEKEIDDI 3507 baker's yeast
19173514 2674 NDKKEYVLRLFIDNSKSMYSQEMIDTLLSLYSKINRSFSLLG-IPVEVYRFGEVLERCP--VEEMRFNDSRTMVDWIDEF 2750 Encephalitozoon c...
19075870 3273 LCESASIIVQFITDLTVGEFQLCLKCLLSFSQHAASLRICHG-IDAMLLNIYHYFEQFLSKVSEAIHTQKQSLENSIKER 3351 fission yeast
6323135  3508 ILLASWKDVNVDALKQSSRKSHNNLYKIVRKYRDLLNGDAKTIIEAGLLYSNenKLKLPTLKQHFYEDpNLEASKNLVKE 3587 baker's yeast
19173514 2751 NDGINIILT--DGLFQNAGYNHPNFLVLLVDKCDVRKMSKVIVSEGSIFVQR--YLDTFPFKYCIISG-VDELESTFIMA 2825 Encephalitozoon c...
19075870 3352 ILLMSWKDTNVYALKESAKKSHAELFKVLHRYREVLRQPVSSYLSQKHDWDS--LLDTENNSAMWVAK-KVNLSPSYIEK 3428 fission yeast
6323135  3588 ISTWSMRAAPLR--NIDTVASNMDSYLEKISsQEFPNFADLASDFYAEAERLRKETPNVYTKENKKRLAYLKTQKSKLLG 3665 baker's yeast
19173514 2826 LSELISS------------------------------------------------------------------------- 2832 Encephalitozoon c...
19075870 3429 MDTEIMKLVPVRfsNTPTTLRLMWTLFANVE-KPGSTFTNMVSNLITDARELMKLTPETINDDNLSEIKHLKSRKHLLLT 3507 fission yeast
6323135  3666 DALKELRRIGLKVNFREDIQKVQSSTTTILANIA--PFNNEYLNSSDAFFFKILDLLPKLRSAASNPSDDIPVAAIERGM 3743 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3508 ETFKTLKAFGLQYRVKAGIEENLSNLRNLLAVIPtfPVTSLSIEKVDRSLMKSLDFIPKFQTLAGHQHNDLSVPEVQKGV 3587 fission yeast
6323135  3744 ALAQSLMFSLITVRHPLSEFTNDYCKINGMMLDLEhftcLKGDIVHSSLKANVDNVRLFEkwLPSLLDYAAQTLSVISKY 3823 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3588 GLFNSMLSLQLGERAQLVEFTNELLALKNVYSEVG----VNGSPLESFNNSSFNEVSSLG--YDHDFENRAQAVSMLCQI 3661 fission yeast
6323135  3824 SATSEQQKILLDAKSTLSSF------FVHFNSSRIFDSSF--------IESYSRFELFINELLKKLENAK-ETGN-AFVF 3887 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3662 YAIVIQKHSSISPTASFQSIghelsrFADLLSNKLFPSSIplyasadkVSSIRDQQKGINDLIEYCRKKRtELPElSYCF 3741 fission yeast
6323135  3888 DIIIEwIKANKGgpIKKEQKRGPSVEDVEQA-FRRTFTSIILSFQKVIGDGIESISETDDnwlSASFKKVMVNV-KLLRs 3965 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3742 KHLVS-LQSLKS--ISRTQVDLTNDEFLNLMnFVLNLFDSLLSSIETATKNMRTFKELAE---TSSFIEMSSCFsKVLR- 3814 fission yeast
6323135  3966 SVVSKNIETALSLLKDFDFTTTESIYVKSVISFTLPVITRYYNAMTVVLERSRIYYTNTSRGMYILSTILHSLAKNGFCS 4045 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3815 AFNLKFQSMKLSSLKEKLRSSSVDKMSCQLLMLFLPVCEQFINLAESVLDYFINVHNSNLDSLSKISTLFFMVANNGFCS 3894 fission yeast
6323135  4046 PQPPSE-EVDDKNLQEGTGLGDGEGAQNNNKDVEQDEDLTEDAqNEnkeQqDKDERDDENEDDAVEMEGDMAGELEDlSN 4124 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3895 PDLPQEgKSNSGELESGTGLGSGVGAEDITNTLNEDDDLEELA-NE---E-DTANQSDLDESEARELESDMNGVTKD-SV 3968 fission yeast
6323135  4125 GEENDDEDTDSEEEELDEEIDDLNEDDPNAIDDKMWDDKASDNSKEkdTDQnldgKNQEedvQAAENDEQQRDNKEggDe 4204 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 3969 VSENENSDSEEENQDLDEEVNDIPEDLSNSLNEKLWDEPNEEDLLE--TEQ----KSNE---QSAANNESDLVSKE--D- 4036 fission yeast
6323135  4205 DPNAPEDGDEEIENDEnAEEENDVGeQEDEVKDEEGEDLEANVPEIET-LDLPEDMNLDSEHEESDEDVDMSDgMpdDLn 4283 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4037 DNKALEDKDRQEKEDE-EEMSDDVG-IDDEIQPDIQENNSQPPPENEDhLDLPEDLKLDEKEGDVSKDSDLED-M--DM- 4110 fission yeast
6323135  4284 keEVGNEDEEvkqesgiESDNENDEPGPE-EDAGETETALDEEEGAEEDVDMTNDEGKEDEEnGPEEQAMSDEEELKQDA 4362 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4111 --EAADENKE-------EADAEKDEPMQDfEDPLEENNTLDEDIQQDDFSDLAEDDEKMNED-GFEENVQENEESTEDGV 4180 fission yeast
6323135  4363 AMEENKEKGGEQNTEGLDGvEEKADTEDIDQEAAVQQDSGSKGAGADATDTQEQD-----DVGGSGTTQNTY---EEDQ- 4433 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4181 KSDEELEQGEVPEDQAIDN-HPKMDAKSTFASAEADEENTDKGIVGENEELGEEDgaaesGVRGNGTADGEFssaEQVQk 4259 fission yeast
6323135  4434 -EDVTkNNEESREEATAALKQLGDSMKEYHRRRQdIKEAQTNGEEDENLEKNNErpdeFEHVEgANTETDTQALGSATQD 4512 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4260 gEDTS-TPKEAMSEADRQYQSLGDHLREWQQANR-IHEWEDLTESQSQAFDDSE----FMHVK-EDEEEDLQALGNAEKD 4332 fission yeast
6323135  4513 QLQTIDEDMAIDDDREeqEVDQKELVEDADDEKMDideeEMLSdiDAHDANndvDSKKSGfigkrkseedfENELSNEHF 4592 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4333 QIKSIDRDESANQNPD--SMNSTNIAEDEADEVGD----KQLQ--DGQDIS---DIKQTG-----------EDTLPTEFG 4390 fission yeast
6323135  4593 SADQEDDSEIQSLIENIEDNPPDASASLT--PE-RSLEESRELWHKSEISTADLVSRLGEQLRLILEPTLATKLKGDYKT 4669 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4391 SINQSEKVFELSEDEDIEDELPDYNVKITnlPAaMPIDEARDLWNKHEDSTKQLSIELCEQLRLILEPTLATKMQGDFRT 4470 fission yeast
6323135  4670 GKRLNMKRIIPYIASQFRKDKIWLRRTKPSKRQYQIMIALDDSKSMSESKCVKLAFDSLCLVSKTLTQLEAGGLSIVKFG 4749 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4471 GKRLNMKRIIPYIASQFKKDKIWMRRVKPSKRTYQVMISIDDSKSMSESGSTVLALETLALVTKALSLLEVGQIAVMKFG 4550 fission yeast
6323135  4750 ENIKEVHSFDQQFSNESGARAFQWFGFQETKTDVKKLVAESTKIFERARAMVHN----DQWQLEIVISDGICEDHETIQK 4825 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4551 EQPELLHPFDKQFSSESGVQMFSHFTFEQSNTNVLALADASMKCFNYANTASHHrsnsDIRQLEIIISDGICEDHDSIRK 4630 fission yeast
6323135  4826 LVRRARENKIMLVFVIIDGITSNE--SILDMSQVNYIPDQYGNPQLKITKYLDTFPFEFYVVVHDISELPEMLSLILRQY 4903 baker's yeast
19173514      --------------------------------------------------------------------------------      Encephalitozoon c...
19075870 4631 LLRRAQEEKVMIVFVILDNVNTQKksSILDIKKVYYDTKEDGTMDLKIQPYIDEFAFDYYLVVRNIEELPQLLSSALRQW 4710 fission yeast
6323135  4904 FTDLASS 4910 baker's yeast
19173514      -------      Encephalitozoon cuniculi
19075870 4711 FQQMSNT 4717 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap