Conserved Protein Domain Family
prfA

?
PRK00591: prfA 
peptide chain release factor 1; Validated
Statistics
?
PSSM-Id: 234801
Aligned: 885 rows
Threshold Bit Score: 470.714
Threshold Setting Gi: 15806000
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
60680383    4 NNSILEKLDGLVARFEEVSTLITDpavIADQKRYVKLTKEYKELDDLMKARKEYMQLLANIEEAKDIls---neS-DADM 79 
56552405    2 IAISPDRLAAIIARREELQAEMARpd--lDSNRLVALSREYSEVEPVALAAENVGRLREEGETLEAMtk----dD-DPEL 74 
260753918   2 IAISPDRLAAIIARREELQAEMARpd--lDSNRLVALSREYSEVEPVALAAENVGRLREEGETLEAMtk-----ddDPEL 74 
85375680    1 MTIPATRLDQIANRFAELEARMASg-tL-EGEEFVQASRDYAELEPVAKVAAEVKAMREEIGGLEEMl------A-DPEM 71 
148555445   2 AGITSARIAQIEARRDELQALMARg-dL-PSDQFVQLSKDYAEIEPVAQAAGEVRRLRAELDVLKGMaed--eaG-DAEL 76 
294010049   1 MHISAERIAQIEARRDEVQASMTRa-dL-APEEFVRLSKEYAEIEPVAKAAHEVRRLRQELSALEYMaggedadS-DPLM 77 
87198313    1 MSVSDARLAQIAARFAELEARLASg--TLEGADFIAASRDYAELEPVARVAEEVREMRGELVSLAAL-------D-DPDM 70 
89054297    3 ATLPRDRLRQITDRFEYLEAQLNG---GPDPSDIAKISREYAELKPVVAEIAGYEQLLADMAEAQNM-------LaDPDM 72 
99080782    1 -MIPEDRLQQILQRYQYLEAAMAD----GAGGDIAKLAKEYSDLRPVVEQISAYQQLLSDLAEAEEM-------LaDPDM 68 
110680314   1 -MIPLDRLRQITERFQYLEAAMAA---GDGAADIAALAKEYSDLRPVVEQISAYQQLLSDLEDAAEMl-------gDPDM 69 
60680383   80 REMAKEEMDNSQERLPVLEEEIKLLLVPADPQDGKNAILEIRGGTGGDEAAIFAGDLFRMYAKFCETKGWKMEVSSANEG 159
56552405   75 QAMAVEELEANKTALAEAERALALSLLPRDAADERSAILEIRAGTGGDEAALFGGDLLRMYSRYAEEHGWRVEMISASAA 154
260753918  75 QAMAVEELEANKTALAEAERALALSLLPRDAADERSAILEIRAGTGGDEAALFGGDLLRMYSRYAEEHGWRVEMISASAA 154
85375680   72 KAMAQEELAAIREALPEKERQLAIAMLPKDSADNKPAMLEIRAGTGGDEAALFAGDLYRMYERFAGEQGWKVEPVSMNAS 151
148555445  77 RAMAIEEAEEIRARLPEAERALALKLLPRDAADERSAMLEIRAGTGGDEAALFAGDLFRMYQRYAEDRGWRVELISASAA 156
294010049  78 REMAQEEMQLIKSRLPDAERALALQLLPKDAADARPAMLEIRAGTGGDEAALFAGDLFRMYQRYADAQGWKMELISANAS 157
87198313   71 RELADEELARIRAELPEAEHRLAVAMLPRDSADARPAMLEIRAGTGGDEAALFAADLFRMYERYAAEQGWRVETISVNAN 150
89054297   73 RPLAEEELPRLEAAIPAAEQSLQLALLPKDAADAKPAMIEIRPGTGGDEAALFAGDLLRMYTRYAEARGWRLEIVDLQES 152
99080782   69 KALAEEEIPTLKAALPQAEHALQLALLPKDEADSRAAILEIRPGTGGDEAALFAADLYRMYSRYAETQGWKVDVIEEQAS 148
110680314  70 APLAEEEIPRLKSALPQAEAALQLALLPKDKADAKPAMLEIRPGTGGDEAALFAGDLFRMYQRYAETQGWKVDLIELQET 149
60680383  160 AAGGYKEIICSVTGDNVYGTLKYESGVHRVQRVPATETQGRVHTSAASVAVLPEAEEFDVVINEGEIKWDTFRSGGAGGQ 239
56552405  155 ELGGYKEVVISITGAGVFARLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEEVDVDIDERDLRIDIFRSSGPGGQ 234
260753918 155 ELGGYKEVVISITGAGVFARLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEEVDVDIDERDLRIDIFRSSGPGGQ 234
85375680  152 EVGGFKEIVANVSGTGVFAKLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEPDEVDVQIDDKDLKIDIYRASGAGGQ 231
148555445 157 DLGGYKEVVASVTGAGVFARLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEEVDVHIDDKDLRIDVYRSSGPGGQ 236
294010049 158 EVGGYKEVVASVTGTGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPEEVDVQIADSDLKIDIYRASGAGGQ 237
87198313  151 DLGGYKEVVANVAGQGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPDEVDVAIEDKDLKIDIYRASGAGGQ 230
89054297  153 DLGGIKECTARVEGENVFARLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDIDIPATDIRIDTMRASGAGGQ 232
99080782  149 ELGGLKELVARINGDGVFARLKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEDVDIKIDANDLRIDTMRASGAGGQ 228
110680314 150 ELGGIKEVVAHIKGADVFARLKYESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIHIDANDLRIDTMRSSGAGGQ 229
60680383  240 NVNKVESGVRLRYiwkNPnTGvaeeILIECTETRDQPKNKERALARLRTFIYDKEHQKYIDDIASKRKTMVSTGDRSAKI 319
56552405  235 SVNTTDSAVRITH---IP-SG----IVVSQQDEKSQHKNKAKAMKVLRARLYERERERLHSERAGQRKSMVGSGDRSERI 306
260753918 235 SVNTTDSAVRITH---IP-SG----IVVSQQDEKSQHKNKAKAMKVLRARLYERERERLHSERAGQRKSMVGSGDRSERI 306
85375680  232 HVNTTDSAVRITH---LP-TG----IVVQQQDERSQHKNKAKAMQVLRTRLYDHLREQSQGEEAAARKAMVGSGDRSERI 303
148555445 237 SVNTTDSAVRITH---LP-TG----LVVIQQDEKSQHKNKAKALKVLRTRLYEMERERLASERAGARKSMVGSGDRSERI 308
294010049 238 HVNTTDSAVRITH---LP-SG----IVVTQQDERSQHKNKAKAMQVLRARIYEAERERAQSEQAGARKAMVGSGDRSERI 309
87198313  231 HVNTTDSAVRITH---LP-SG----LVVTCQDERSQHKNKAKAMQVLRTRLYDMRREAAQGAEAEARKAMVGSGDRSERI 302
89054297  233 HVNTTDSAVRITH---VP-SG-----IVVVSSEKSQHRNREIAMQTLRTRLYDLERQKADDAMAADRKAQIGSGDRSERI 303
99080782  229 HVNTTDSAVRITH---LP-TG-----LVVTSSEKSQHRNREIAMQVLKTRLYDLERQRIDTERSADRASQVGSGDRSERI 299
110680314 230 HVNTTDSAVRITH---LP-TG-----LVVTSSEKSQHRNREIAMQVLKARLYDLERSRVDDERSADRAAQVGSGDRSERI 300
60680383  320 RTYNYPQGRITDHRINYTIYNLAAFM-DGDIQECIDKLTVAENAERLKESEL 370
56552405  307 RTYNFPQGRVTDHRINLTLHRLPEILaGPGLDEVISALIAEDEAERLASLDD 358
260753918 307 RTYNFPQGRVTDHRINLTLHRLPEILaGPGLDEVISALIAEDEAERLASLDD 358
85375680  304 RTYNFPQGRVTDHRIGLTLHKLDEIIaGPGLGELVGALIAEDEAKRLAALSE 355
148555445 309 RTYNFPQGRVTDHRINLTLHRLSEILeGPGLDDLVGALIAEDEAERLAQLDG 360
294010049 310 RTYNFPQGRVTDHRINLTLHRLPEILeGPGLSEVIDALVAEDEAARLAQLDG 361
87198313  303 RTYNFPQGRVTDHRINLTLHRLPEILeGPGLAELIDALIAEDQSKRLAAMDG 354
89054297  304 RTYNFPQGRMTDHRINLTLYKLDAVM-LGDLDEIVDALTAEDQAMKLAEMTG 354
99080782  300 RTYNFPQGRMSDHRINLTLYKLDQIM-GGDLDEIIDALISEHQAKLLAEMGQ 350
110680314 301 RTYNFPQGRMTDHRINLTLYRLDAVL-QGDLDEIIDALTAHAQAQLMADMGQ 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap