Conserved Protein Domain Family
sucC

?
PRK00696: sucC 
succinyl-CoA synthetase subunit beta; Provisional
Statistics
?
PSSM-Id: 234813
View PSSM: PRK00696
Aligned: 654 rows
Threshold Bit Score: 481.897
Threshold Setting Gi: 300786451
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
284035901   1 MNIHEYQGKEILKKYGVRIQEGIVAESPEKAVEAAKLLiaqsgQKFVVVKSQIHAGGRGKGQivgseqrGVALAKSVDAV 80 
13541105    1 MNLYEYMGKDIFREYGIPVPNGYVVSSPQDVKKFTNPV---------AVKSQILLGGRGKAG-------GIKFAKTDEEL 64 
16082611    1 MNLYEYMGKDIFRQYGIPVPNGYVVSSVDEVRKLTNPV---------AVKSQILLGGRGKAG-------GIKFAKTDQEL 64 
257388754   1 MKLHEYQAKQVFADAGVPTPASTLATTVDEAVDAAEEI-----GYPVAIKAQVQVGGRGKAG-------GIKLAENADEA 68 
284165339   3 MKLHEYQAKQVFADAGIPTPASELASDVDGAVAAAEEI-----GYPVAIKAQVQVGGRGKAG-------GIKLVEDEDEA 70 
289580418   3 MKLHEYQAKQVFADAGVPTPSSQLASDVDGVLTAAEEI-----GYPVAVKAQVQVGGRGKAG-------GIELVENDEEA 70 
300710740   1 MKLHEYQAKSVFADAGIPTPDSQLAESTEEVLSAAESV-----GYPVAVKAQVQVGGRGKAG-------GIELVENDEEA 68 
48478075    1 MNLYEYMGKEIFRNYGIPVPDGYTIEKTDEIRDVSYPVa---------IKSQILIGKRGKAG-------GIKFADNKNDA 64 
55377354    1 MRLHEYQAKQVFADAGIPTPASQLAETVDEAVDAAEEI-----GYPVAIKAQVHVGGRGKAG-------GIKLVESKEEA 68 
76802812    1 MKLHEYQAKGVFADAGIPVPESTLASTVDEAVEAADDI-----GYPVAIKAQVQVGGRGKAG-------GIKLVENADEA 68 
284035901  81 RDITKNLIGNILvthqtgpEGKRVNKVLIAEdvyypGPSEPKEMYIGILLDRTKACNVIMASTEGGMDIEEVAEHSPEKI 160
13541105   65 KNAVSTLLSTKV-------RNMTVTKVLIED-----MLNIKHEYYVSIALNRAAKSPMLIASAMGGMEIENVPD---DKI 129
16082611   65 KDAVKALLGAKV-------RNLTVTKVLIED-----MLNIKHEYYVSITLNRSARAPTVIASAMGGVEIETVPD---EKI 129
257388754  69 REYADDILGMDL-------KGLHVDRVLVEE-----AVDFVNELYVGVTMDRGEGKPVAMVSTRGGVNIEEVAEEEPEAI 136
284165339  71 REAADEILGMDL-------KGYHVDRVLVEE-----AVDFTNELYVGITMDRGEGKPVAMVSTKGGVNIEEVAEEDPDAI 138
289580418  71 REAAESIIGMDL-------KGYHVGQVLVEG-----AVDFTDELYVGITMDRGEGKPVAMVSTKGGVNIEEVAEEDPDAI 138
300710740  69 REAADSILGMDL-------KGYTVERVLVEE-----AVDFVDELYVGVTMDRGEGKPVAMVSRKGGVNIEEVAEEDPDAI 136
48478075   65 VKYASELLGSKI-------NGMTVTKLLIEK-----KLDIKKELYLSITMDRTNRAPVIIASTEGGMDIEEVPD---DKI 129
55377354   69 REAAEDIIGMDL-------KGYHVSKVLVEE-----AVDFVNELYVGVTMDRGEGRPVAMVSTKGGVNIEEVAEEDPDAI 136
76802812   69 REAADEILGMDL-------KGLHVDRVLVEA-----AVDFTDELYVGVTMDRAAGKPVAMVSTRGGVNIEEVAEEDPDAI 136
284035901 161 VKEWIDPAVGLQPFQARKVAFGLGLEGEAFKEMVKFVTALYKAYVDTDASMFEINPVLKTSDNKILAVDAKVNLDDNALY 240
13541105  130 FKRIIDPSLGYSDFIGREASQFMGLPPELSKQFLDILKKLYNVYRGEDCELVEINPLVETGDGKLIAADAKVVIDSDAIY 209
16082611  130 FKRIIDPSLGYSDFIGREASTFMGLSPDLSKQFLDLLKKLYNVYKGEDAELVEINPLVETNDGKLIAADAKVVIDSDAMF 209
257388754 137 AREHIDPAFGMHHYQARKVVYDAGVDREVANDVAGVLKTLYDLWEDKDGSDAEINPLMVTADDEVIAADAVMNVDDDALF 216
284165339 139 AREHIDPAFGMHPYQARKAVYDAGVDQSIARDVSSVLTTLYQLWDDRDGSDAEINPLMVTSDDEVIAADAVMNIDEDALF 218
289580418 139 AREHIDPAFGMHPFQARKAVYDAGVDKSVANDVASVLTTLYDLWESRDGSDAEINPLMVTADDEVIAADAVMNIDEDALF 218
300710740 137 AREHVDPAFGLQPYQARRVVYDAGIDREVAGDVSSVLTTLFSLWDDRDASDTEINPLMVTSDGEVIAADAVMNIDEDALF 216
48478075  130 VKRVIDPLIGYSQYIGREIVSSMKLDADLSKSFLEILERLYRVFMGEDALLVEINPLVIDGNKNIIAADSKIVLDDNALF 209
55377354  137 AREHIDPAFGMHPFQARKVVYEAGVDREVANDVASVLTTLYQLWDDRDGADTEINPLMITSDDEVIAADAVMNVDGDALF 216
76802812  137 VREHIDPAFGMHPFQARKAAFEAGVDRAVANDVASILTQLYELWADKDATEIEVNPLMVTDDDEVIAADAVMNIDEDALF 216
284035901 241 RHLDLKAMRDLAE--EDPLEVEASANDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPANFLDVGGGANAKTVEAGF 318
13541105  210 RHREF-SIQDPEK---TPLELKAEGKGYAFVELDGDIGVIANGAGLTMATLDALLLHKGKPRNFLDLGGTDNVDIVINAF 285
16082611  210 RHREF-NIQDPEK---TPLELKAEGKGYAFVELDGDIGVIANGAGLTMATLDALLLHKGKPRNFLDLGGTDNVDIVVNAF 285
257388754 217 RHPDLEAMEDEADg-GDELEQKADEYGFDYVRLSGNVGIIGNGAGLVMTTLDLVDHFGGEPANFLDVGGGAKAQRIANAL 295
284165339 219 RQPELAEMEEEAAg-GDELEQKADEYDFDYVRLDGNVGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAERIANAL 297
289580418 219 RQPELAEMEEEAAsgGDELEQKADEYGFDYVRLEGNVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKAERIANAL 298
300710740 217 RQAELAEMEEESY--TDDLERKAGEYGFDYVRLEGDVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKADRIANAL 294
48478075  210 RHKEI-NIRDPEK---TELEIESQSKSFTFIEMDGDIGVIANGAGLTMATLDALTLHNLKPRNFLDLGGTDSIDIVKDAF 285
55377354  217 RQPEIAEMGEEAAe-GDELEQKADEYGFDYVRLDGNVGIIGNGAGLVMTTLDLVDYYDGEPANFLDVGGGAKADRIANAL 295
76802812  217 RHPDLEEMEEEAA--GDELEAKANEYGFDYVRLSGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDIGGGAKAERVANAL 294
284035901 319 RIILKDPNVKAILINIFGGIVRCDRVATGVVEAYKAIGdIPVPIIVRLQGTNAEEGAKIIDESglKVQSAVLLKEAAEKV 398
13541105  286 DLVL-EAKPKAILVNIFGGVTKCDTVAQGIVEAKKKFD-IKIPVVVRLSGVHEVEGRKILQDN--GIEAFSEMMPAIERV 361
16082611  286 DLVL-EAKPKAILVNIFGGVTKCDTVAQGIVDAKKKFD-IKIPIVVRLSGIHEEEGRQILKEN--GIEAFSEMMPAIERV 361
257388754 296 DMVFSDDNVDSVVFNIFGGITRGDEVAKGINQALEQFDeIPKPVVVRLAGTNATEGMEILNED--LVTVEQTLEDAVERA 373
284165339 298 DMVFSDDNVDSVVFNIFGGITRGDEVARGINEALEQFDeIPKPVVVRLAGTNWEEGMEILNED--LVTVEQTLEDAVQRA 375
289580418 299 DMVFSDDNVDSVVFNIFGGITRGDEVAKGINEALEQFDeIPKPVVVRLAGTNWEEGMEILNED--LVTVEQTLEDAVQRT 376
300710740 295 DMVFSDENVESVVFNIFGGITRGDEVAKGINNALEQFDeIPKPVVVRLAGTNAEEGMEILNAD--LVQVEQTLEEAVQRA 372
48478075  286 SFVMKADP-DIIFVNIFGGVTKADTVANGIVASKKEFN-ITKPIVVRLSGIHEDEGRRILKDN--GINAFSNMNDAILDI 361
55377354  296 DMVFSDENVDSVVFNIFGGITRGDEVANGINQALEQFDeIPKPVTVRLAGTNAEEGMEILNED--LVTVEHTLEDAVQRA 373
76802812  295 DMVFSDDNVDSVVFNIFGGITRGDEVAKGINEALEQFDeIPKPVVVRLAGTNAEEGMEILNTD--LVTVEKTLEDAVQRA 372
284035901 399 RQVVEAL 405
13541105  362 TKVF--- 365
16082611  362 TKVF--- 365
257388754 374 VIYAEEV 380
284165339 376 VEYAGEV 382
289580418 377 VEYAEEV 383
300710740 373 VENAQEV 379
48478075  362 VKIKEGK 368
55377354  374 VEYAKEV 380
76802812  373 VKYAEEE 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap