Conserved Protein Domain Family
PRK03918

?
PRK03918: PRK03918 
DNA double-strand break repair ATPase Rad50
Statistics
?
PSSM-Id: 235175
View PSSM: PRK03918
Aligned: 10 rows
Threshold Bit Score: 681.019
Threshold Setting Gi: 296109493
Created: 9-Dec-2010
Updated: 17-Jun-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11498637    2 ILLKELQIKNFRSHSDSKIEFDTGINLIAGRNGAGKSSILEAILVAFY----GLKPATLRKNDLVRVNSS-GYSLSLTFS 76 
284161186   1 MLIKYVEIENFKSHRSSRVEFDRGVNLIVGRNGAGKTSILEAIAVALYgvkhGVKPSGVKKDDLIRDSAS-RYEIRLGFD 79 
18977539    1 MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYw---pLRIKDIKKDEFTKVGAR-DTYIDLIFE 76 
14521425    1 MKIEEVKVYNFRSHEETVVRFRKGINLIIGQNGSGKSSLLDAILVGLYws-kKLRLRGLKKDEFRRIGGKgGTRIEIKFE 79 
14590782    1 MKIERVIVQNFRSHKNSEIEFKPGINLIIGQNGAGKSSLLDAILVGLYws-kRMRLRGLKKDEFTRTGTR-GAIIEITFE 78 
242398089   9 MRIRSLKIKNFRAHENSHVEFNDGINLIIGQNGSGKSSILEAVFASLYlg-hGSFPRGYKKVN-TRIGKS-GFELVLKFE 85 
240103799   1 MRVRKIEIRNFRAHRKSIVEFSDGINLIIGQNGAGKSSILEAIFASLYlg-hPSFPKGYLKAN-ARVGTG-ELSLGLEFE 77 
57642146    1 MKIEKLIIKDFRSHALTKVNFSSGINLIIGQNGSGKSSILDALLVGLYw---pSKPKDLKKDDFERINGS-GTEITVFFE 76 
212224573   1 MKIEKLIIKDFRSHKLTKVTFTSGINLIIGQNGSGKSSLLDALLIGLYw---pSKPKDLKKDDFLRIGGT-TTEITVFFE 76 
296109493   1 MKIEELKIINFRSHKSSVLEFTDGINLIVGPNGSGKSSILEAILVGLYwd-kPRN----KIKDFHRDGKK--AEIEMKLK 73 
11498637   77 LNGDDYTISRKSN------GESILTGKEI-------VEGDSNITEWVERhLCPAHVFTGAIYVRQGEIDSIIRDDESRER 143
284161186  80 FNGRDCLIVRSSD------GNSYLRCDKL-------LEGDERIREWVERnVAPSHVWLNAIYVRQGEIDEIVKDDERREK 146
18977539   77 KDGTKYRITRRFLkgyssgEIHAMKRLVGnewkhvtEPSSKAISAFMEK-LIPYNIFLNAIYIRQGQIDAILESDEAREK 155
14521425   80 NDDSKYVLFRDFSr-----NVAYLKVQENgkwrhasEPSMESVSSYIER-ILPYNVFLNAIYIRQGQIDAILESDETRDK 153
14590782   79 EDGTKYKVLRDFAr-----NVSYLKRLDGrewrhvtETSMESVSSFIDR-IIPYNVFLNAIYVRQGQIDAILESDETRDK 152
242398089  86 HNGKNYEIVRKSN------GESYLKENGGv-----lHEKDSDIARWSERyLYPLHVFRNALYIRQGEIENILVDEDVREK 154
240103799  78 HNGKTYRITRTTKkselleNGKLI------------AEKSSEVARWVERnVYPLQVYTNALYIRQGEIEGIITNREVMEK 145
57642146   77 KGNVKYQIHRNIGr-----GLAFVKYHDGssw-ktlETGQKPVRDWMEK-LVPYDVFLNAIYIRQGEIDAILESDESREK 149
212224573  77 KDGVKYQIHRNITr-----GLSFVKYHDGssw-rglESGQKQVRDWMEK-LVPYDVFLNAIYIRQGEIDAILESDESREK 149
296109493  74 LNNRSCKLLRSFPr-----NTAYLRYSDSyl---neRDGHRKTTEEIES-FIPYEIFLGAIYIRQGEINKLIESDEEREK 144
11498637  144 IIRQITRIEDYENAWKNLGAVIRMLEREKERLKEFLSQEEQIKRQKEEKKAEIERISEEIKSIESLREKLSEEVRNLESR 223
284161186 147 IIKRITQIEDYERAWENLGKVIKHFKEEKSRLEKEIKAESDVENRIKEVKEELEAKKRELDKKMIELRDVEEKLAEAEAE 226
18977539  156 VVREVLNLDKFETAYKKLSELKKTINNRIKEYRDILARTENIEELIKENEQELIQVLQEISKIEEVLPSKRSKVDMLRKE 235
14521425  154 VVREILNLDKLESAYENLKRIKTNINLLIESKKSFIARTENIEELIKANEDELTKKLSEINEISSKLPPIRGELEKVREN 233
14590782  153 IVKEILNLDKLEKAYDNLGKIRKYIKYSIEEKEKFIMKTENIEDLIRTQEKSFTEVLNEIRNISSNLPRLRRELEGIKEE 232
242398089 155 VLRKVLGIEDFENSANNAQEVLRELRKKREYLEKLIQASGDIQNKIKEQEKRLGEVIHKINELRKKEIETAEKLSAVSKR 234
240103799 146 VLRKVLGIEDYENAERNSAEVIRELKRRRENLKKLIERKAEVEDRLSEAGKRFAETLRRISELRKRERELSAEVEKLSKL 225
57642146  150 VVRQVLGLDRYENSYKNLLDVRKEIDARIKAIEDYLKSTENIDELIGNLEKELTSVLREINEISPKLPELRGELGGLEKE 229
212224573 150 VVRQVLGLDRYENAYKNLLEVRKEIDARIRAIEDYLKSTENIDELIGNMEKELAETLKVINELSPEIPKLIKELEGVEKR 229
296109493 145 VVKQILGLDKYEKADERLKNIKKLINFKMDNIEKFLSREEEIKKRLKEKEEKKEEIEKRVKLLNDEIRQLEEEREKVRRE 224
11498637  224 LKELEEHKSRLESLRKQESSVLQEVRGLEEKLRELEKQLKEVVERIEDLEKKAKEVKELKPKAERYSILEKLLSEINQAL 303
284161186 227 KERVEKLREKFEELNREKESIEKHAGKIEERIRGLRERRNGLKKEIEELKSRVRRLEEIRGYAEKYIELREEYEKTLKVE 306
18977539  236 VLRLEETKVEIENSERLLEKRRGDKRTLEERIKNTEEYLEKLKEKEKELEEQVKEITSIKKDVDAYLALKEFKNEYLDKK 315
14521425  234 VKELESIKGKISELKIQVEKLKGRKKGLEEKIVQIERSIEEKKAKISELEEIVKDIPKLQEKEKEYRKLKGFRDEYESKL 313
14590782  233 VKTLEATFNSITELKLRLGELNGKKGRLEERIRQLESGIEEKRKKSKELEEVVKELPELEKKETEYRRLIEFKDEYLVKK 312
242398089 235 YEELKEIKEILTQKEKEKLSVEGSMKKLEADIKNTRDRIAELEKELRVLRDKEGRLKEIEWVKKEYETLNALMVK-RKEL 313
240103799 226 YQEMKERKELIAGLEKRIALLEKSLASEEELLKEREKRIEELKLELEELEEKRARLEELKPLAEEYIELGKLL-KLKDEL 304
57642146  230 LKELEKTAEELAKARVELKSEEGNLRELEAKKSGIQSMIRETEKRVEELKEKVKELESLEEKAKEYERLSRFYRNFTEGI 309
212224573 230 LRDLDALAEEINALQLETRKREGNVKALEAKLQELEKRIEESRSHLRELEEKVRESNKLKGSAELYLKLVEFRKQYVDEK 309
296109493 225 KEKYDKLREEINEKKEKNLKLEKEIEALKIKLGEIEERIKEKEEEIKKLEKNIERVKEIEEEALTYVKISKFYEDYKERS 304
11498637  304 RDVEKREGDLTREAAGIQAQLKKAEEDNSKLEEITKRIEELERELERFEKSHRLLETLKPKMDRMQGIKAkleeKNLTPD 383
284161186 307 RELKETLARLESERNGVIRLLSDLENKKKRLNELKGKLEEVEKRKSEIEGKALKYEEIKVKLERLRELEK----TCRPLE 382
18977539  316 YKIEKELTRVEELINEIQKRIEELNEKESEKEKLENEKKEILNKLAILEKDHQLYEEIKAKKENLRQLKEk--lGDKSPE 393
14521425  314 RRLEKELSKWESELKAIEEVIKEGEKKKERAEEIREKLSEIEKRLEELKPYVEELEDAKQVQKQIERLKAr--lKGLSPG 391
14590782  313 NELEKRLGILSNRLQEVKRKIKDAESKVARIRWIEERLKEIQEKIMKLEPRVREFEDAMRLKAQMESLKSk--lGGLEPE 390
242398089 314 QEIELRKSRLEERIKVLQKQIQELESKSEELEETKKLEKKLLDDYNVLKTFAETYDMVRQLVVEKEKYSTelekAGYTKE 393
240103799 305 SNVEVGLSSLREKLRSLEREMEKREELERKLGELKKKEVETRREYERLKERHKLYQRALSILGEAEKHRKelerAGYTVE 384
57642146  310 NRIEKLLATYSQQAENLRERIDELSKKEARVKELLKEKEGLQKELGALEEDLKAYQRAKELMANLERLKKrltlSEEEIE 389
212224573 310 ANGEKLAENYRAQISGIEERLAELSDMKNRIGELEKKREELKKKLAELEESVKAYEEARALKTNLDRLRKrlkfEPEEIE 389
296109493 305 YKISKELEKYSQLIEGVEEKLSEISSKEEEVKKLSEEFKELKRRVEELKEWEELFNKVRAKENELNNIKKr--iTINNIE 382
11498637  384 KVEKMYDLLSKAKEEekeITEKLKKLIAKKSSLKTRGAQLKKAVEELKSAERTCPVCGRELDEEHRKNIMAEYTREMKRI 463
284161186 383 EIERELEEVERAKLKlkdVEKDERNLLDMKARLESEIERLKEALNALKSAKGVCPTCGRLLSEDDRLNLIKSYTKKLENV 462
18977539  394 DIKKLLEELETKKTT---IEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNS 470
14521425  392 EVIEKLESLEKERTE---IEEAIKEITTRIGQMEQEKNERMKAIEELRKAKGKCPVCGRELTEEHKKELMERYTLEIKKI 468
14590782  391 KINEKLLYLENRKKE---LEEEIDKITRKIGELNQRSKDRRLAIIELKKARGKCPVCGRELTEEHKADLLRKYSLELSSI 467
242398089 394 KLVNEIKNVEKAKKElkeVEDKILTLKGELNGLDKIEKSLRDNVSKLEGAK-ECPLCKRPIEEHEEGEIKREYTAELAKI 472
240103799 385 KLEKELKEIEKAKEElerLREEISKVRERIASLRGKRAELEANMERLEGAK-ICPLCRRPIDEHEEGEILAEYRAEISRI 463
57642146  390 KLEAEIQKARERKEE---IMKELEEIGSRRGELKSIAGERNKALMELKKAKGRCPVCGRELTEEHRKELLEKYTAELKEI 466
212224573 390 RLAAEIEAAKKRKEE---IQRELEEINEKRGELKNRVSERNKAIIELKKAKGKCPVCNRELTEEHRKGLMERYLAEVKDV 466
296109493 383 EAKRKLEEAKKRKEE---VTLEISKLEAEIRNIEKEIKEKKKAINELKEAKGKCPVCGAELTEEHKERLINEYKEEIKDL 459
11498637  464 AEELAKADEIEKKLKERLEKVEKALEKQETVLKYRQMVDELKALENELSSHdaEKLSAESEEYRKVKERLDGLRGQQKIL 543
284161186 463 RKDLIEIENKLEDIKNVKKELESVISEESRILREYELAKELENLKKSTKGF--EEAEAAWKEYRKLEELALKLSADISVI 540
18977539  471 KNTLAKLIDRKSELERELRRIDMEI---KRLTPLLTVAEQIRSIEEELNVVnlEKIEKNATEYEKLLEELRTLEGRIRGL 547
14521425  469 EEELKRTTEEERKLRVNLRKLEIKL---REFSVMRDIAEQIKELESKLKGFnlEELEQKEREFEGLNEEFNKLKGELLGL 545
14590782  468 EKEIQEAKALERQLRAEFRKVENEL---SRLSSLKTIADQIIEIRERLSKInlEDLKRDKEEYELLKSESNKLKGEVESL 544
242398089 473 EKKKEEIAEALRKALKRKTELEKIRNNESKLIKLHKTLEFLENVESKLEKYniEELKKKTEEFEKVRERVIEVKKEIIRV 552
240103799 464 ESEVKTFGEKLEELRKREVELRKLLAREPKLIRLKKTADLLREAEEKLEELgvEELERDAKLFEETKEKLIGLKKEIRNV 543
57642146  467 SAEMKELEKREKKLRAELVEVEKTLKKERELFALKEVLEQIRETEEKLKEYdlEKLEEANEKAEELKKKLAGLEGEIKSL 546
212224573 467 SKEIKELDSQERKLRRELVKVEGVLKGERELITQRELLEQIKELEEKLKSYdlKKLEKKAEDYENLKGKLGKIEGELKSL 546
296109493 460 LKRKKEIEEKISELKKEAKNIETFLLKEPEIRKNESLYDQLKSLEEELGKInkEEVEEKYRELETLKRKSIEIGSKISTL 539
11498637  544 LSSASRIKELKSSLREIEEALKNVESERGELHRKireegfesleeLEREVQSLRPFYNKWLELKDAESRLESELKRREKL 623
284161186 541 ESDLKSEQELNSKLIELNSKIDEVEEKLSNLKKI-----------DESTLKELESYYNEFNRLVSAKHDLERKLEELKSC 609
18977539  548 AEDLKKLAPLEKKLAALIHKKQELEKELKELNTKlesfgfksvedLDSKLRELEEIYKRYLTLLNSKKELEITQREIAKA 627
14521425  546 ERDLKRIKALEGRRKLIEEKVRKAKEELENLHRQlrelgfesveeLNLRIQELEEFHDKYVEAKKSESELRELKNKLEKE 625
14590782  545 KKEVNELNDYKNESTKLEIEIDKAKKELSEIEDRllrlgfktideLSGRIRELEKFHNKYIEAKNAEKELRDILESLKDE 624
242398089 553 NKELEKLNEFKNEKETLLRKLGDLERKKAEVLHEieekgfesfedVEKRLKELEPLYKEYISLSNVPQEIQIREKRQELL 632
240103799 544 KERLEELEGLEKEKRAVEKELHTLEERKADILKRlsergfssfdeVEERIGELEKPYREFLSLKDIPRRIEALEKKLDIE 623
57642146  547 EDEIKKGELLKKKLALVEKKLRELEEERASLLGElkklgfgdvkeLEERLKELEPAYKRYIELRPARDELKREEDLLKSL 626
212224573 547 KDELEKAKALEKKKAVLEKKLKSIEEKLAELENElgelgfsdikeLDEKLSELEPAYRRYLELKGAESELEREKKRLKRT 626
296109493 540 KKEIERKEELIKRLEELKNKKEEKEEELKKLIKElenlgfsceeeVKEEIERLKPIYEEYIKLKDSVKEKEEKEEEIKKL 619
11498637  624 EDEISEAIAKLEEANGKAEEIRGQIDELLriYSEEEHRRLSDEHLRKSKELAGLKSRLETLRESLQSAEKDLKFLEEQLA 703
284161186 610 ESEIVKAEDELSETLKRLESLKNEIEALG--YSDETYRNVYNLYTELRSRYFGLREGVERLKDHIKTLEKSAEDLENRVK 687
18977539  628 KETLEMSFEELAEVEADIERIEKKLSQLKqkYNEEEYKKKREEKEELEKELARLEAQKKELEKRRDTIKSTLEKLKAEKE 707
14521425  626 KTELDQAFEMLADVENEIEEKEAKLKDLEskFNEEEYEEKRERLVKLEREVSSLTARLEELKKSVEQIKATLRKLKEEKE 705
14590782  625 REELDKAFEELAKIETDIEKVTSQLNELQrkFDQKKYEEKREKMMKLSMEIKGLETKLEELERRRDEIKSTIEKLKEERK 704
242398089 633 ETTLKDKEKDLNLTKNVFKMLSKEIEELKvrFTVEEFEKISKEYLSLSSLHAAVLKEIEGNENLKEEVARNLEDLKRQLE 712
240103799 624 QRKADESRANIARLKAELEKARKELEEARkeFSEEDFERAEREYLEKSRALERARAELEGAESLRDEIARLIDELKANLG 703
57642146  627 KLDLTAILKEIEKTSKRVEELRKRVEELEksYDKDRHEELKGKTRELSNELAGLEARLKSLEERRDEVKASLEKLREEKE 706
212224573 627 EEELEETREKLQGEFSSLEELRKRLNEKEklYSPEEHAGIRERFTSLREELAGKRAQLEALEKKREETMENLKKLKEEKE 706
296109493 620 ANEVEKISKYIDVKDKALRELKERLEELNknYSEEEHKNLENKFLELEREYSRKDEEFKQLNSQLEEIIKDLDNLKRDLD 699
11498637  704 KMDEYRKKVEVFEKiAIPELTRIREKFRKYRNLVAENSMREVERYASQIFEELTEGKYSGVRLKKTtergKEKLKVFVVY 783
284161186 688 KLREKRERVEKIGReVLPKLEEIREKFRKYKVSLTEYAFKEVEKIASEIFEEMTDGKYSGIVLKREek-rKEKVTVKVLY 766
18977539  708 NRERVKKEIKDLEK-AKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAE----ENKVRLFVVW 782
14521425  706 EREKAKLEIKKLEK-ALSKVEDLRKKIKDYKTLAKEQALNRISEIASEIFSEFTDGKYSNVIVRAE----ENKTKLFVVY 780
14590782  705 ERESAKMELEKLNI-AIKRIEELRGKIKEYKALIKEEALNKIGEIASEIFSEFTDGKYSGIAIRAE----DNKVKLFVIY 779
242398089 713 AIKKAKEESELIEK-MMADMKVLREKLLKLKAEAERRGLSEVERVASELFSDMTERKYQGIKIIREkkfgRERIRIVVLY 791
240103799 704 EIEKAERELELIEK-ALADLTAFREKIARLKAEEELRGLEEVQKLAGELFSEMTEGKYQGIRLRREkrygKERIELKVLY 782
57642146  707 TRKEKAKELEKLKK-ARERVQRLREKVKAYKNLLKEGALAKVGEMASEIFEELTEEKYSGVTVKAE----ENKVRLGVVY 781
212224573 707 ERKEKIKELENLKK-ARERVQNLREKVRRYKAMLKEGALAKVGELASEIFEELTEEKYSGVTVKAE----ENKVKLGVIY 781
296109493 700 EISKYREEIKSLEK-ALEFVEELRKKVKEFKNKLKCHAFQKVSEIASEIFEELTEEKYSGVAIKEK----GNKLIVNIIY 774
11498637  784 QGEEREIGFLSGGEIIALGLAFRLALSMFMIrGKIPLLILDEPTPFLDEERRRKLVDITTNYLRKIPQVIIVSHDEELKD 863
284161186 767 QGAERDISFLSGGELIALGLAFRLALSVFMIqGKIPLLILDEPTPFLDDERRRKLVDIMNRYLKKIPQVIVVTHDEELRD 846
18977539  783 EGKERPLTFLSGGERIALGLAFRLAMSLYLA-GEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD 861
14521425  781 EGKEVPLTFLSGGERIALGLAFRLALSMYLV-GRIDLLILDEPTPFLDEERRRKLLDIMERHLRRISQVIMVSHDEELKD 859
14590782  780 DGVERPLTFLSGGERIALGLAFRLAMSMYLI-GKVDLLILDEPTPFLDEERRRKLIEIMERHLRKISQVIIVSHDEELKD 858
242398089 792 QGQEEEIDFLSGGERIALGLSFRLALSLYKV-KNMELLILDEPTPFLDEERRKKLVEIITQHLRKIPQVIIVSHDEELKD 870
240103799 783 AGNEVGIDFLSGGERIALGLAFRLALSLYKV-GNLELLILDEPTPFLDEERRKKLVEIISSQLRKIPQVIIVSHDEELKD 861
57642146  782 NGKEYGLGFLSGGERIALGLAFRLALSLYLA-GEISLLILDEPTPYLDEERRRRLVDIMQRYLRKIPQVIVVSHDEELKD 860
212224573 782 NGKEYGLGFLSGGERIALGLAFRLALSLYLA-GEISLLILDEPTPYLDDERRRRLVDIMQRYLRKIPQVIVVSHDEELKD 860
296109493 775 EGKERNLNFLSGGEKVALGLAFRLALSLYLA-GNIPLLIMDEPTPYLDEERRRRLVDIIERYLKRIPQVIIVSHDEELKD 853
11498637  864 AADKVIFVESQGGVSRVRYVEA 885
284161186 847 VADKVIRVELHGGVSKVMEGFE 868
18977539  862 AADHVIRISLENGSSKVEVVS- 882
14521425  860 AADYVIRLRLEGGKSKVEVVS- 880
14590782  859 AADHVIRIRLEGGASKVEVVS- 879
242398089 871 AADYVIRVSLIGGKSNVEVESL 892
240103799 862 AADYVIRVT-NAGEARVEVESL 882
57642146  861 AADRVIRVSLENGVSVVREAEV 882
212224573 861 AADRVIRVSLENGVSSVREVEL 882
296109493 854 AADRVIRVSLNNGVSKVEVE-- 873
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap