Conserved Protein Domain Family
PRK05367

?
PRK05367: PRK05367 
aminomethyl-transferring glycine dehydrogenase
Statistics
?
PSSM-Id: 235432
View PSSM: PRK05367
Aligned: 488 rows
Threshold Bit Score: 1038.55
Threshold Setting Gi: 294055374
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
269954854    5 SPA-LDPDLFA-TRHVGPGgaeSAQVRAMLDVLGYPSLDAVVDAAVPAAIR---TQRPL----DLPAARTEPEVLADLRA 75  
78780145     1 MKStVNSDLFI-NRHLGLS---DVDEQKMLSKIGFNNIDQFINQVIPEDIQlndKSSEI----LPQ-GCSEIEALNELEE 71  
157414274    1 MTSkVGSDLFI-DRHLGLG---DNDEKIMLNKLGFKNIDQFINQVIPEDIQlkdKPSEI----LPQ-GCSEIEALNELDE 71  
123969409    1 MTSkFGSDLFV-DRHLGLG---DNDERIMLNKLGFNNIDQFINQVIPEDIQlkdKSSEI----LP-QGCSEIEALNELEE 71  
123967091    1 MNPsINSDLFI-GRHLGLK---ENDEKKMLQKLGFNNIDEFINQVIPEDIQ---FKEKYsnslPI--GCSEIEALNELEE 71  
126697196    1 MTSkFGSDLFI-DRHLGLG---DNDERIMLNKLGFNNIDQFINQVIPEDIQikdKSSEI----LPQ-GCSEIEALNELEE 71  
33862224     1 MNPkSNTDLFI-DRHLGLN---DNDEKKMLQKLGFNNIDEFIHQVIPEDIQlkeKCSDV----LPK-GCSEIEALNELEE 71  
28493102     1 ----------MhERHIGPS---QEEIDHMLGFLGYKSLDDLMNAALPNGVQ---SPPDI----KIP-SHDELTCLTQLAA 59  
28572307     1 ----------MhERHIGPS---QEEIDHMLGFLGYKSLDDLMHAALPNGVQ---SPPDI----KIP-SHDELTCLTQLAA 59  
189220181    1 ------MDSFI-KRHIGSS---EEEIQQMLEFLRLKSLDELIEKVIPSCCR---TSTGL----HLPDEASEEEALRELKQ 63  
269954854   76 IAAKNQVKRQMIGLGYYPTHTPPVIRRNVLESPAWYTAYTPYQPEISQGRLEALLNFQQVVEDLTGLEVAGASLLDEATA 155 
78780145    72 IANKNTKMRSLIGLGYYDNHMPKVIQKHVLENPRWYTSYTPYQAEIAQGRLEALFNFQTIVCELTGFPIANASLLDEGTA 151 
157414274   72 IAKLNAKMRSLIGLGYYDNHMPKVIQRHVLENPRWYTSYTPYQAEIAQGRLEALFNFQTIVCELTGFPVANASLLDEGTA 151 
123969409   72 IANKNTKMRSLIGLGYYDNHMPKVIQRHVLENPRWYTSYTPYQAEIAQGRLEALFNFQTIVCELTGFPVANASLLDEGTA 151 
123967091   72 ISNKNHKIRSLIGLGYYGTHTPKVVQRHVLENPRWYTAYTPYQAEIAQGRLEALFNFQTLICELTAFSVANASLLDEGTA 151 
126697196   72 IANKNTKIRSLIGLGYYDNHMPKVIQRHVLENPRWYTSYTPYQAEIAQGRLEALFNFQTIVCELTGFPVANASLLDEGTA 151 
33862224    72 ISNKNHKFRSLIGLGYYGTHTPKVIQRHVLENPRWYTAYTPYQAEIAQGRLEALFNFQTLICELTGFSIANASLLDEGTA 151 
28493102    60 YAKMNRIKTSMLGQGFYNCITPAVIRRNILENPSWYTSYTPYQPEISQGRLEMLINFQTMICDLTGLEIANASMLDEASC 139 
28572307    60 FAKMNRIKTSMLGQGFYNCITPAVIRRNILENPSWYTSYTPYQPEISQGRLEMLINFQTMICDLTGLEIANASMLDEASC 139 
189220181   64 IGSENKVFRYFIGMGFTETLCPSVIRRMVLENPEWYTPYTPYQSEISQGRLEALLNFQTLVSDLTALPVANASLLDEASA 143 
269954854  156 VAEAVALMWRASR----AttgYVVLDADLFPQTLAVTRGRAEAIGLPVVVA----NLdqglaaglEAaashaAsdpasdv 227 
78780145   152 AAEAMAMSFAARKnkssK---LYLVESNVFDHTFNVLQTRAKPLGISLKRF----NQsn-----lPN-----H------- 207 
157414274  152 AAEAMAMSFAARKnkssK---VYLVESNVFDHTFNVLQTRAKPLGISLKRF----TQsn-----lPN-----H------- 207 
123969409  152 AAESMAMSFSARKnkssK---VYLVESNVFDHTFNVLQTRAKPLGISLKRF----TQsn-----lPN-----H------- 207 
123967091  152 AAEAMTMSFSARKnkssN---IFLVDENVFDHTFNVLLTRAKPLGIDLKRF----NQkh-----lKN-----Y------- 207 
126697196  152 AAEAMAMSFSARKnkssK---VYLVESNVFDHTFNVLQTRAKPLGISLKRF----TQsk-----lPN-----H------- 207 
33862224   152 ASEAMTMSFSSRKnkssN---TFLVDENVFDHTFNVLLTRAKPLGIKLKRF----NQky-----fNN-----H------- 207 
28493102   140 AAEAMLLAKRVSRss-sN---KYLVHNGVFPHIRRVLETRADAVGVEIVDL----PEgq-----sID------------- 193 
28572307   140 AAEAMLLAKRVSRss-sN---KYLVHNGVFPHIRRVLETRADAVGVEIVDL----PEgq-----sID------------- 193 
189220181  144 CAEAMLMCNRLSAsnnrK---KFFLSKDCHPQILSVMVTRSSPLGIELVIEdwqkAKi---------------------- 198 
269954854  228 aaaSaglssglpegDVVGVVVAQTGASGRVLDARQVIAEAKERGALVTMATDPLALTILVSPGELGADIAVGSAQRLGVP 307 
78780145   208 ---D----------DVFGILLQLPGKNGELFDPTFLISQAHRSEIIVTGCIDPLAQVLIKPISEFGVDVAVGSMQRFGVP 274 
157414274  208 ---D----------DVFGILLQLPGKNGQLFDPTFLISQAHRSEIIVTACIDPLAQVLIKPISEFGIDVAVGSMQRFGIP 274 
123969409  208 ---D----------DVFGMLLQLPGKNGQLYDPTFLISQAHRSEIIVTACIDPLAQVLIKPISEFGVDVAVGSMQRFGVP 274 
123967091  208 ---D----------DVFGLLIQLPGKNGELFDPTFLVSQAQKAEIIVTSIIDPLAQVLIKPIAEFGVDIAVGSLQRFGVP 274 
126697196  208 ---D----------DVFGMLLQLPGKNGELYDPTFLISQAHRSEIIVTACIDPLAQVLIKPISEFGVDVAVGSMQRFGVP 274 
33862224   208 ---D----------DVFGLLIQLPGKNGDLFDPTFLISQAHKAEIVVTSIIDPLAQVLIKPIAQFGVDIAVGSLQRFGVP 274 
28493102   194 ---F----------DHFGVYAQYQSASGKLLDLRHLFSRSKRAGAICVIGCDLLMLTLFTSPGELGADIAFGSAQRFGIP 260 
28572307   194 ---F----------DHFGVYAQYQSASGKLLDLRPLFSRSKRAGAICVIGCDLLMLTLFTSPGELGADIAFGSAQRFGIP 260 
189220181  199 --dE----------SFFGALVAYPDTQGRIFDYGGFCEELHRKGLVVAVNTDLLALCLFKAPGEFGADIAVGSAQRFGLP 266 
269954854  308 LFYGGPHAAYIAVRKGLERQLPGRLVGVSVDADGATAYRLALSTREQHIRREKATSNICTAQALLAITAAMYAVYHGPDG 387 
78780145   275 LGFGGPHAAFFACSEKYKRLIPGRIVGQTLSKNGEKSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYAIYHGPTG 354 
157414274  275 MGFGGPHAAYFACSEKYKRLIPGRIVGQTLSKNGEKSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYAIYHGPSG 354 
123969409  275 MGFGGPHAAYFACSEQYKRLIPGRIVGQTLSKNGEKSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYAIYHGPSG 354 
123967091  275 MGFGGPHAAFFACSEKYKRLIPGRIVGQTLSKNGEQSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYAIYHGANG 354 
126697196  275 MGFGGPHAAYFACSEKYKRLIPGRIVGQTLSKNGEKSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYAIYHGPSG 354 
33862224   275 MGFGGPHAAFFACTEKYKRLIPGRIVGQTLSKNGEQSLRLALQTREQHIRREKATSNICTAQSLLAIISSFYATYHGSLG 354 
28493102   261 MNFGGPLASFLAARKAMERSLPGRLVGVSVDADSNHAYRLTLQTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKG 340 
28572307   261 MNFGGPLASFLAARKAMERSLPGRLVGVSVDADSNHAYRLTLQTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKG 340 
189220181  267 LSFGGPHPAFIAARKGMERKMPGRIVGVSKDAFGNPALRLALQTREQHIRREKATSNICTAQVLPAVVASMYAVYHGAEG 346 
269954854  388 LRAIAERIHTHATTLTTALRAAHITVEHDTFFDTIRThvpaQ-----AATIAAQARAAGLNLYTPDHDH--------VQI 454 
78780145   355 LTQIAKRLVQLRINLESCLADLGFDIPDGIRFDSVDV----Yse--hSQKIHNEALNNGYNLRIL-PLGstienstgFGI 427 
157414274  355 LTQIAKRLVVLRRNLESCLVDLGFDIPDGIRFDSVDV----Yse--hSQKIHNEALKNGYNLRIL-PLGstiedstgFGI 427 
123969409  355 LTQIAKRLVELRINLESSLAALGFDIPDGIRFDSVDV----Yse--hSQRIHNEALKNGYNLRIL-PLGstienstgFGI 427 
123967091  355 LTKMAKRLVLLRRYLESCLCELGFKIPLGNRFDSVDI----Yce--eSEKIHKEALKNGFNFRIL-PLGssiedstgFGI 427 
126697196  355 LTKIAKRLVELRINLESSLAALGFDIPDGIRFDSVDV----Yse--hSHRIHNEALKNGYNLRIL-PLGstienstgFGI 427 
33862224   355 LTKMAKRLVVLRRYLESLLSELGLKIPLGSRFDSFDI----Yce--eSEKIHKEALKNGFNFRIL-PLGssieeskgFGI 427 
28493102   341 LRAIAHRINTVAVGFARLLKQTAFRVSSLDIFDTIEI----Nnp--tQLCVEAESKHDLLFWKVD-DNK--------LRI 405 
28572307   341 LRAIAHRINTVAVGFARLLKQTAFRVSSLDIFDTIEI----Nn---pTQVCVEAESKYDLLFWKVDDNK--------LRI 405 
189220181  347 LKALAKKILSYSYYLYRQFSFSGFSPSSFPFFDTLKV----PlkkeqMEEIKKRALSCGYLFREF-KDEt------aLGI 415 
269954854  455 ACDETTTDAD---IAAVLQAF--TQalgshtsapeaapmheagrsddarAAVNPRvegprgpvNaaarasSDVPAap--- 526 
78780145   428 SLDEMSNEKE---IEDILTFIanVIek---------------------kEDLDNIk-------Fdq-------------- 462 
157414274  428 SLDELSNEKE---IKDIVTFIanLIek---------------------kEDLEHIk-------Fdk-------------- 462 
123969409  428 SLDELSNEKE---IKDILTFIanLLek---------------------eDDLEHIk-------Fdk-------------- 462 
123967091  428 SLDELTDENE---IRKIVSLIanGVgk---------------------kEDFKHIk-------Vnn-------------- 462 
126697196  428 SLDELSNEKE---IKDILTFIanIIek---------------------eEDLEHIk-------Fdk-------------- 462 
33862224   428 SLDELTDKNE---IHKIVNCVanGLgr---------------------kEDLTHIt-------Lnn-------------- 462 
28493102   406 TFDEVTARLDgdlPERLSKVFgiSPdkirdlgcny----dscdcsfysdSQQAREg-------L------SSVASrnisv 468 
28572307   406 TFDEVTARLDgdlPERLSKVFgiSPdkirdlgcny----dscdcsfygdLQQAREg-------L------SSVASrnisv 468 
189220181  416 TLGEKTTLED---LGCILNIFavG---------------------------------------E------KKVAPscadi 447 
269954854  527 -aeTLPEPLKRTTPFLQHPVFHQHRSETAMLRYLRSLSDKDLALDRTMIPLGSCTMKLNATAEMEPISWPEFADLHPYVP 605 
78780145   463 -gfQLESLALRSTEWMQQDIFTTYQSETELMRYIFRLAEKDFSLVDGMMPLGSCTMKLNSAAELNPVSWANLSSIHPFSP 541 
157414274  463 -vfHLESLPLRSSEWMQQDIFTNYQSETELMRYIFRLAEKDFSLVDGMMPLGSCTMKLNSAAELNPVSWADLSSIHPFSP 541 
123969409  463 -efHLESLALRSSEWMQQDIFTNYQSETELMRYIFRLAEKDFSLVDGMMPLGSCTMKLNSAAELNPVSWANLSSMHPFSP 541 
123967091  463 -sfHFEGIPLRNKEWMQQNIFENYQSETDLMRYIFKLAEKDFSLVDGMIPLGSCTMKLNSAAELSPISWANLSSIHPFAP 541 
126697196  463 -dfHLESLALRSSAWMQQDIFTNYQSETELMRYIFRLAEKDFSLVDGMMPLGSCTMKLNSAAELNPVSWANLSSMHPFSP 541 
33862224   463 -cfQFEGIPLRNKEWMQQNVFENYQSETDLMRYIFKLAEKDFSLVDGMIPLGSCTMKLNSAAELSPISWANLSSIHPFAP 541 
28493102   469 hsdLARHPLRRFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMIPLGSCTMKLNAAFQLEPVLWPEFANLHPFAP 548 
28572307   469 hsdLARHPLRRFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMIPLGSCTMKLNAAFQLEPVLWPEFANLHPFAP 548 
189220181  448 klpEIPRSLERQTEFLNQGVFKNYRTETKLGRYIKRLAAKDINLTTSLIPLGSCTMKLNPASAMIPILWDCFTEPHPFAP 527 
269954854  606 ADQAEGYEELISALEAGLAEITGYAAVSLQPNAGSQGEFAGLLAIRAYHRSRGEEGRDIVLIPASAHGTNAASAALAGLR 685 
78780145   542 PNQTKGYSKIISDLEKWISDIVGLKSVSFQPNAGSQGEFAGLLAINSYFVSKGELSRKKCLIPKSAHGTNPASAVMAGFD 621 
157414274  542 PDQTKGYAKIISDLEKWISDIVGLKSVSFQPNAGSQGEFAGLLAINSYFESKGELSRKKCLIPKSAHGTNPASAVMAGFD 621 
123969409  542 LDQTKGYSKIISDLEKWISEIVGLKSVSFQPNAGSQGEFAGLLAINSYFESRGELLRKKCLIPKSAHGTNPASAVMAGFD 621 
123967091  542 ANQTRGYSKIISDLEKWISELIGLNSVSFQPNAGSQGEFAGLLAINSYFASKGDLARKKCLIPQSAHGTNPASAVMAGFD 621 
126697196  542 PDQTKGYSKIISDLEKWISEIVGLKSVSFQPNAGSQGEFAGLLAINSYFESKGELLRKKCLIPKSAHGTNPASAVMAGFE 621 
33862224   542 ANQTNGYSKIISDLEKWISDLIGLNSVSFQPNAGSQGEFAGLLAINSYFSSKGDLLRKKCLIPQSAHGTNPASAVMAGFD 621 
28493102   549 RGDADGTLQIIDQIETWLANLSGYDAVSLQPTAGSQGELAGLLAIRGYYKSL-NLDRDVCLIPASAHGTNAASAVLAGMR 627 
28572307   549 LGDADGTLQIIDQIETWLANLSGYDAVSLQPTAGSQGELAGLLAIRGYYKSL-NLDRDVCLIPASAHGTNAASAVLAGMR 627 
189220181  528 EETTQGHHKLAADLGRWLAEITAMDHVSLQPNAGSQGELAGLLAIRLYLRSIGEDRRTICLIPTSAHGTNCASAALAGLT 607 
269954854  686 VVVVKTAADGEIALDDLREKLAQHGPQVAAIMITYPSTHGVYEEHVREVCDAVHDAGGQVYIDGANLNALVGLARPAELG 765 
78780145   622 VLTVECDEEGNIDFQDLSIKVTKFDTQIGALMLTYPSTHGVFELQIRKICDLIHSIGGFVYLDGANLNAQVGLCKPGNYG 701 
157414274  622 VLTVECDDEGNIDFQDLLIKVKKFDNQIGALMLTYPSTHGVFELQIRKICDLIHSVGGFVYLDGANLNAQVGLCKPGNYG 701 
123969409  622 VLTVECDDEGNIDYQDLSIKVKKFDNQIGALMLTYPSTHGVFELQIRKICDLIHSVGGFVYLDGANLNAQVGLCKPGNYG 701 
123967091  622 VVTIKCDSEGNISYEDLLIKVKELDNKIGALMLTYPSTHGVFELKIKEICELIHSVGAFVYLDGANLNAQVGLCKPGDYG 701 
126697196  622 VLTVECDDEGNIDYQDLSLKVKKFDNQIGALMLTYPSTHGVFELQIRKICDLIHSVGGFVYLDGANLNAQVGLCKPGNYG 701 
33862224   622 VVTIKCDSEGNISYEDLLNKVQEFDNTIGALMLTYPSTHGVFELKIREICDLIHSVGAFVYLDGANLNAQVGLCRPGDYG 701 
28493102   628 VVVVACDQQGNIDLDDLRLKASKNAHALAALMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANSNALIGYLRTGDFG 707 
28572307   628 VVVVACDQQGNIDLDDLRLKASKNAHALAALMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANSNALIGYLRTGDFG 707 
189220181  608 IEEVKCDNRGRLDLEDLEQKANRYASELAAIMITFPSTYGIFEETLVEASRIVHDHGGQVYLDGANANAFLGLCKPGELG 687 
269954854  766 GDVSHLNLHKTFCIPHGGGGPGVGPVAVAAHLAPFLPGDPvgggvvstgsttgdgstTVGGSTTGGGVPVSAARHGSAGI 845 
78780145   702 VDICHLNLHKTFCIPHGGGGPGVGPVAASETLSPFLPTHS-----------------LKDNNLSNSSNYVSSAKHGSASI 764 
157414274  702 VDVCHLNLHKTFCIPHGGGGPGVGPVAASEALSPFLPTHS-----------------LVDNNLSSTSNYVSSARHGSASI 764 
123969409  702 VDVCHLNLHKTFCIPHGGGGPGVGPVAASETLSPYLPTHS-----------------LMDNNLSNSLNFVSSAKHGSASI 764 
123967091  702 VDVCHLNLHKTFCIPHGGGGPGVGPVATSDILSPFLPSHS-----------------LTDNIFSHLGYSVSSSQHGSASI 764 
126697196  702 VDVCHLNLHKTFCIPHGGGGPGVGPVAASETLSPYLPTHF-----------------LMDNNLSNSFNFVSSAKHGSASI 764 
33862224   702 VDVCHLNLHKTFCIPHGGGGPGVGPVATSETLSPFLPSHS-----------------LKDNTFSQFGYSVSSSQHGSASI 764 
28493102   708 GDVSHLNLHKTFGIPHGGGGPGIGPVVAKAHLAPFLPFRNrvh-----------kpsTDLPAVKHMGGPIASSDYGFAGA 776 
28572307   708 GDVSHLNLHKTFGIPHGGGGPGIGPVVAKAHLAPFLPFRNrvh-----------kpsTDLPAVKHMGGPIASSDYGFAGA 776 
189220181  688 VDVCHLNLHKTFCIPHGGGGPGVGPIAVKKHLQPFVPSTR------------------IDLPSQGKMGLLCSSPLGNAGV 749 
269954854  846 LPISYAYVALMGPDGLTHATKTAVLAANYVARRLADHYPTLYTGPGGLVAHECILDLRPLTAATGVSAEDVAKRLMDYGF 925 
78780145   765 LPISWMYIKMAGLCGLRKATSHAILSANYIAHTLKHKFKILYKGKNNFVAHECILDFRDLKSKTGLSVNDLAKRLIDYSF 844 
157414274  765 LPISWMYIKMAGLSGLKKATEHAILSANYIANSLKHKFKILYKGRNNFVAHECILDFRDLKSKTGLSVNDLAKRLIDYSF 844 
123969409  765 LPISWMYIKMAGLSGLRKATSHAILSANYIAHSLKHKFKILYKGKNNFVAHECILDFRDLKSKTGLSVNDLAKRLIDYSF 844 
123967091  765 LPISWMYIKMAGQSGLRKASTHAILSANYIANKLKNKFRILYKGQNNFVAHECILDFRDLKSKTGLSVNDIAKRLIDYSF 844 
126697196  765 LPISWMYIKMAGLSGLRKATSHAILSANYIAHSLKHKFKILYKGKNNFVAHECILDFRDLKSKTGLSVNDLAKRLIDYSF 844 
33862224   765 LPISWMYIKMAGQRGLRKASSHAILSANYIANTLKNKFKILYKGQNNCVAHECILDFRELKSKTGLSVNDIAKRLIDYSF 844 
28493102   777 LYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSDTFPVLYTGKNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGF 856 
28572307   777 LYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSDTFPVLYTGKNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGF 856 
189220181  750 LPVSWMFIRMAGKNGLKLCSQLAILNANYMAKRLESSFDILYKGEHGYVGHEFIIDLRPWKEY-GIEVEDVAKRLMDYGF 828 
269954854  926 HAPTLSFPVAGTLMVEPTESEDLAELDRFVDAMIAIKGEIDAVGAGEWPADDNPLRNAPHTAQSVSADEWTHPYPRSLAA 1005
78780145   845 HAPTISWPVPETIMIEPTESESLAELDRFCEAMLLIGEEISEIENNIELNNNNVISNAPHTLKELIADTWNYPYSKEKAS 924 
157414274  845 HAPTISWPVPETIMIEPTESEGLAELDRFCEAMLLIGEEISEVENNNELKNNNVISNAPHTLKELIADNWQYPYSKEKAS 924 
123969409  845 HAPTISWPVPETIMIEPTESESLAEVDRFCEAMLLIGEEISEIENNYELKNNNVISNSPHTLKELIADNWQYPYSKEKAS 924 
123967091  845 HAPTISWPVPETIMIEPTESESLTELNRFCEAMLLISEEIEEIENNIDLKNNNLISNAPHTISELISDNWNYPYSKEKAA 924 
126697196  845 HAPTISWPVPETIMIEPTESESLAELDRFCEAMLLIGEEISEIENNHELKNNNVISNAPHTLKELIADNWQYPYSKEKAS 924 
33862224   845 HAPTISWPVPETIMIEPTESESLTELNRFCEAMILISEEIEEIENNINLRNNNLISNAPHTINELIADNWNYPYSKEKAA 924 
28493102   857 HAPTMSFPVPGTLMVEPTESEPFSEIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWDRPYSRRTGI 936 
28572307   857 HAPTMSFPVPGTLMVEPTESEPFSEIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWDRPYSRRTGI 936 
189220181  829 HAPTISWPVHGTMMIEPTESESKDELDRFCEALILIRKELEDIKKGVYPLGNNPLKNSPHPHHAVCADRWALPYPRKLAA 908 
269954854 1006 YPVPALRGAKYWPPVRRIDAARGDRTLICSC-P----PPESYA 1043
78780145   925 FPYGTQTAIKFWSAVSRINNAYGDRNLICSC------NVNQEE 961 
157414274  925 FPYKTPTTIKFWSSVSRINNAYGDRNLICSC------NVNQGQ 961 
123969409  925 FPYKTPTTIKFWSSVSRINNAYGDRNLICSCnvnqdeTLEEKK 967 
123967091  925 YPYKGKYEYKFWSSVSRIDNAYGDRNLICSCnV----NDQDFL 963 
126697196  925 FPYKTPTNTKFWSSVSRINNAYGDRNLICSCnvnqneTLEEKK 967 
33862224   925 YPYKGKFEHKFWSSVSRIDNAYGDRNLICSCnV----NDKDFL 963 
28493102   937 VYTSG----KYWPASARIDNAYGDRNIFCTC-P----DLPD-- 968 
28572307   937 VYTSG----KYWPASARIDNAYGDRNIFCTC-P----DLPD-- 968 
189220181  909 YPAPWQKEFKYWPPTGRIDNVYGDRNFVCRIeK---------- 941 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap