Conserved Protein Domain Family
PRK07561

?
PRK07561: PRK07561 
DNA topoisomerase I subunit omega; Validated
Statistics
?
PSSM-Id: 236048
View PSSM: PRK07561
Aligned: 383 rows
Threshold Bit Score: 1002.78
Threshold Setting Gi: 116621517
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237786534   2 KRLVIVESATKARKIQPYLGSDYIVEASVGHIRDLPRGAADvpakykkkpwarlgVDVEND-FAPLYVVNQDKKKKVADL 80  
302877263   3 INLLIVESPAKAKTLKKYLGNDYEVLASYGHVRDLVPKTGA--------------VDTENG-FAMNYETIARNSKHMDAI 67  
91774583    2 SKLLIVESPSKAKTLKKYLGKDFEVLASYGHVRDLVPKTGA--------------VDPDHD-FAMKYEVIDRNARHVDAI 66  
225874955   3 KSLVIVESPAKAKTINKYLGKDFQVEASIGHIKDLPKnk--------------lgVDVEKGtFEPELIVIPGKEKVVDKL 68  
253995662   2 SKLLIVESPSKAKTLKKYLGSDFEVLASYGHVRDLIPKNGA--------------VDTENQ-FAMKYDIIERNSKHVDAI 66  
253997957   2 SKLLIVESPSKAKTLKKYLGSDFEVLASYGHVRDLIPKNGA--------------VDPEND-YAMKYEVIDRNSKHVDAI 66  
291612476   3 TNLLIVESPAKAKTLKKYLGKDFEVLASYGHVRDLIPKTGA--------------VDPDDN-FAMKYETIARNAKHVDAI 67  
297537476   2 SKLLIVESPSKAKTLKKYLGSDFEVLASYGHVRDLIPKNGA--------------VDTAND-FAMKYDIIERNSKHVDAI 66  
74316028    2 SKLVIVESPSKSKSLKKYLGADYDILASYGHVRDLEPRTGA--------------VDTE-N-FSMKYQIIERNAKHVDAI 65  
94970367    3 KGLVIVESPAKAKTIQKYLGKGYEVEASLGHIKDLPK--KGl------------gVDIENN-FDTEYVVIPGKEKVVAKL 67  
237786534  81 KAKLKQVDELYLATDPDREGEAIAWHLLQVLK----------PKVPVRRMVFHEITKPAILEAAKHTRELDQNLVNAQET 150 
302877263  68 AKAAASAENILLAPDPDREGEAIAWHIAELLKakr-----gfKGKNMKRVVFYEITQSAVQAAVANPREIAMPLVNAQQA 142 
91774583   67 AKAVKTADAIYLATDPDREGEAISWHIAEILKskk-----llKDKLIKRVVFHEITKNAVQNAIEEPRDISMPLVNAQQA 141 
225874955  69 RKLATKVDTIYLAPDPDREGEAIAAHLEDELKav------vkKPEAIRRITFNEITPKAVTAALDHARSVDRNLVDAQQT 142 
253995662  67 AKAVKNADSIYLATDPDREGEAISWHIAEILKskk-----llKNKLMKRVVFHEITKGAVEHAIAEPRDISMPMVNAQQA 141 
253997957  67 AKAVRASDAIYLATDPDREGEAISWHIAEILKdkk-----liKDKLIKRVVFHEITKTAVQNAIASPRDISMPLVNAQQA 141 
291612476  68 AKAAAEADHIFLAPDPDREGEAIAWHISELLKgkr-----alKGKTMQRVVFYEITQSAVREAVAHPREISIPLVNAQQA 142 
297537476  67 AKAVKSADSIYLATDPDREGEAISWHIAEILKskn-----llKNKVMKRVVFHEITKSAVEHAIAEPRDISMPMVNAQQA 141 
74316028   66 VKAAKKADEVLLATDPDREGEAISWHISEILKek-------kvKTPMKRVAFYEITESAIQDAVRNPREIASDLVDAQQA 138 
94970367   68 KKLAKDADAIYLAPDPDREGEAIAAHLAEELGdgdgkkkkktDSKPFYRVTFNEITKKAVQEAFAKPREIDRNLVDAQQT 147 
237786534 151 RRVLDRLYGYEISPVLWKKVMPRLSAGRVQSVATRVIVERERDRIAFTSADYWDLTGTFALrSgadaSTPGsstagadta 230 
302877263 143 RRALDYLVGFNLSPLLWRKIRPGLSAGRVQSPALRLIVERELQIEAFKTQEYWSVHLDTQK------NHQS--------- 207 
91774583  142 RRALDYLVGFNLSPLLWKKIRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWTIHLESAK------HQHV--------- 206 
225874955 143 RRVLDRIVGYQISPLLWDKVRRGLSAGRVQTVALRLIVEREQQIKAFKPVEYWTIDAVLKTgG----NPQE--------- 209 
253995662 142 RRALDYLVGFNLSPLLWKKIRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWSIHLDALK------HQHG--------- 206 
253997957 142 RRALDYLVGFNLSPLLWKKIRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWTIHLESKK------HQHL--------- 206 
291612476 143 RRALDYLVGFNLSPLLWRKIRPGLSAGRVQSPALRLIVERELEIEKFKSQEYWSVHLDSQK------NSIP--------- 207 
297537476 142 RRALDYLVGFNLSPLLWKKIRRGLSAGRVQSPALRLIVERELEIEAFKSQEYWSIHLDALK------HSHG--------- 206 
74316028  139 RRALDYLVGFNLSPLLWKKISPGLSAGRVQSPALRMIVEREEEIEAFVAREYWTLHLDSHK------GSQA--------- 203 
94970367  148 RRILDRLVGFQVSPLLWDKVRRGLSAGRVQTVALRLIVEREREIKAFVSKEYWTIDAHL--------HGQKpp------- 212 
237786534 231 sgeprsFPARLAEIDGQRVAQgrdfnddgqlkskAVALDEKAAKDLADQL---SGA-AMSVRSVEEKPYTRRPYPPFMTS 306 
302877263 208 ------FSARLIQYQGKKLEQ-------------LSIASQSEYDAIYAKLn--DAKlPPKVVKVEKKAKQRYAAAPFTTS 266 
91774583  207 ------FDAKLVQLEGKKVEQ-------------FTITNQAQQQEVVGKLlavSAG-KTTVSRVEKKQRSRSPAAPFTTS 266 
225874955 210 ------FTAHFIGIDGERARVetv--------daPALPDQKLTDEVVAQL---HKA-DWSVREVERKERKRNAPAPFTTS 271 
253995662 207 ------FKAKLVQLNNQKVEQ-------------FTVINHDQQSDIVGKLllaSAG-KTTVSRVEKKQRSRSPAAPFTTS 266 
253997957 207 ------FDARLVQLDGSKVEQ-------------FTVTNETQQAEIVGKLllaSAG-KTTVSRVEKKQKNRSPAAPFTTS 266 
291612476 208 ------FKAKLYQFQGKRMEQ-------------LTIGSQAEYDAIHAKLv--DAKlPPKVVRVEKKGKQRSPAAPFTTS 266 
297537476 207 ------FTAKLIQLNNQKVEQ-------------FTVINHDQQSDIVGKLllaSAG-KTTVSRVEKKQRSRSPAAPFTTS 266 
74316028  204 ------FTAKLTHFKGEKLDQ-------------FAVEHEARSKEWLATL---ESK-DARVMRIEKKRRARNPAAPFTTS 260 
94970367  213 -----dFDARFTGIDGEKLEV----------------GNEEESKKIVDQL---DNA-EWSVRSVDNRERRRNAAAPFTTS 267 
237786534 307 TLQQEAGRKLHYTSERTMRIAQRLYE---------NGHITYMRTDSTTLSESGINAARAQARELYGAKYVASAPRQYSRK 377 
302877263 267 TLQQEAVRKLGMSAERTMRTAQSLYEgvdi-ggqtVGLISYMRTDSVSLANEAVAEIRNYIGDHFSSEYLPGTPPTYKSK 345 
91774583  267 TLQQEAVRKLGFTTSRTMRVAQQLYEgidi-gsgtMGLITYMRTDSFSLATEAVMQIRDYIKQNFAAEYLPKSPIMYKTK 345 
225874955 272 KLQQDASRQLGFNVKRTMGVAQRLYEgiei-ggdaVGLITYMRTDSTRVAPEAIEAVRGYIQKKVGKDYLPAAPNAFKSK 350 
253995662 267 TLQQEAVRKLGFTTSRAMRVAQQLYEgvdv-gggtVGLITYMRTDSFSLATEAVMQIRDYVKKNFDTEYLPKSPVMYKTK 345 
253997957 267 TLQQEAVRKLGFTTSRAMRIAQQLYEgidv-gngtVGLITYMRTDSFSMAAEAVMQIRDYIKRNFEPDYLPKSPIMYKTK 345 
291612476 267 TLQQEAVRKLGMTSDRTMRTAQSLYEgvdi-ggqtIGLITYMRTDSVNLANEAVAEMREYIKDNFAGDYLPVKQPVYKSK 345 
297537476 267 TLQQEAVRKLGFTTSRAMRVAQQLYEgmdv-gsgtVGLITYMRTDSFSIAAEAIAQIRDYVKKNFDAEYLPKAAIQYKTK 345 
74316028  261 TLQQAGVRQLGMTTDRVMRTAQQLYEgidl-gegpVGLITYMRTDSVNLAQEAITDIRKYVGANFDKDYLPPHAVQYKAK 339 
94970367  268 KFQQDASRKLGMSVKRAMMIAQHLYEgvelgeegtVGLITYMRTDSTRVSNEALTEVRELIGTSYGPQFLPESPNVYKQK 347 
237786534 378 VKNSQEAHEAIRPAgESFATPGQLgGQLDAEEFKLYELIWQRTVASQMADAKGTSMKVFVAgestdGRD---CVFTATGR 454 
302877263 346 TKNAQESHEAIRPT-SIVRTPDSLqDRLTVDQARLYEMIWKRTLACQMTAARYDTVSADIRl---gGDD---TLFRANGQ 418 
91774583  346 AKNAQEAHEAIRPT-DISRTPASMrAFLTDEQFRLYEMIWKRALACQMTQAKFDAVSIDLA-----VGSd-aNLFRATGQ 418 
225874955 351 -KDAQDAHEAIRPA-DPNLHPDDIrKYLSDEQYKLYRLIWRRFVASQMMPAIFDQTTVEIA-----ARAdrrYDFRVTGS 423 
253995662 346 SKSAQEAHEAIRPT-DISRTPTSVrQYLNDEQFKLYEMIWKRALACQMAPAKFDAVSVDLS-----VGSd-aNLFRATGQ 418 
253997957 346 AKNAQEAHEAIRPT-DITRTPQSLkNYLTPEQFRLYEMIWKRALACQMAPAKFDAVSVDLAvg--sDAN----LFRATGQ 418 
291612476 346 SKNAQEAHEAIRPT-SILRTPDSLrDHLNIDQMRLYEMIWKRTLASQMSPARFDTVSVDIRl---sSDD---TLFRASGQ 418 
297537476 346 SKSAQEAHEAIRPT-DISRTPASVrQYLTDEQFKLYEMIWKRALACQMAPAKFDAVSVDLS-----VGSd-aNLFRASGQ 418 
74316028  340 TKNAQEAHEAVRPT-SVLRTPDAVrQFLTQDQARLYELVWKRTVACQMTAAQFDTVAADIT-----VGE---GTFRATGQ 410 
94970367  348 -KDAQGAHEAIRPS-SVAHTPDDLkAYLKDDEMKVYKLIWQRFVASQMAPAVFDQTTVDIDak--aDRT---YNFRVTGS 420 
237786534 455 TITFPGFLKAYVEVSRTadgrnVADDAEK-------RLPVLTEGQGLTATDIEADGHSTTPPARYTEASLVKKMEDLGIG 527 
302877263 419 VLVFPGFISVYMEDVDD-------AEEEQg-----sRLPPLVEGDILPVDKLFGEQHFTQPPPRFTEASLVKSLEEYGIG 486 
91774583  419 TLIFPGFIAVYMEGVDD-----EEEEGES-------KLPHLETGEVLAVQKIYGDQHFTEPPPRYSEASLVKALEEYGIG 486 
225874955 424 VMKFDGFLRVYEEVKEK---------KDAddealanKLPALNNGDRLALSALKPEQHYTEPPPRYNEASLVKELEERGIG 494 
253995662 419 TLVFPGFIAVYMEGSDD-----EEEEAES-------KLPNLETGEILTVEKIYGEQHFTEPPPRYSEASLVKVLEEYGIG 486 
253997957 419 TMIFPGFIAVYMEGQDD-------AEEEAe-----aKLPHLETGEVLDVNKIFGDQHFTEPPPRYSEASLVKVLEEYGIG 486 
291612476 419 TLVFPGFIGVYMEDVDD-----AEEEDSA-------KLPPLVEGDVLPVDKLYGEQHFTQPPPRFSEASLVKALEEYGIG 486 
297537476 419 TLVFPGFIAVYMEGTDD-----EEEEGES-------KLPHLETGEVLTVEKIYGDQHFTEPPPRYGEASLVKILEEYGIG 486 
74316028  411 TLAFAGFLAVYQDDEDD--------EGES-------KLPALVEGETLPVDRLYGEQHFTQPPPRYTEASLVKALEEYGIG 475 
94970367  421 VLKFEGFLKVYEESKEG------KDEEDDal---khKLPPLVEGQTLTLKAIKPEQHFTEPPPRYNEASLVKELEEQGIG 491 
237786534 528 RPSTYASIIKTIQDRGYVYS---RGNALVPSWVAFAVVGLLEQNFGSLIDYDFTSSMEDVLDSIANGSEDRSHWLEGFYY 604 
302877263 487 RPSTYATIISTLQTREYAIL---DKKRFMPTDVGRVVTRFLTDHFTRYVDYNFTASLEDELDEVSDGKRDWIGVMDEFWK 563 
91774583  487 RPSTYASIISTLQDREYVVL---DKKRFIPTDVGRVVNKFLTEHFTRYVDYGFTANLENELDDIAEGEREWIPVLNEFWQ 563 
225874955 495 RPSTYATIINTIQDREYVQKmggRTGRFIPTEIGTVVTGLLVKNFPYIFDTKYTARLEEELDDIEDGKERWTDLLNGFYD 574 
253995662 487 RPSTYASIISTLQDREYVLL---DKKRFTPTDVGRVVNKFLTEHFTKYVDYDFTANLENALDSVAEGERDWVPLMDEFWQ 563 
253997957 487 RPSTYASIISTLQDREYVLL---DKKRFTPTDVGRVVNKFLTEHFTRYVDYGFTANLENELDDIAEGEREWVPVLDDFWQ 563 
291612476 487 RPSTYATIISTLQAREYATL---DKKRFMPTDVGRVVIKFLNEHFTRYVDYGFTANLEDELDDISEGKRDWIPVLNEFWK 563 
297537476 487 RPSTYASIISTLQDREYVLL---DKKRFTPTDVGRVVNKFLTEHFTKYVDYGFTANLEDALDSVAEGEREWLPLMAEFWQ 563 
74316028  476 RPSTYASIISTLQDREYVVL---EKKRFQPTDVGRLVNCFLTRHFSHYVDYDFTAKLEDKLDDVSNGKRVWSRLLGEFWS 552 
94970367  492 RPSTYAAILSTIQDRGYVQKtpgRGGKFFPTEIGMVVTDLLVANFKDIFDTKFTSRMEEELDEVEDGQKKWTDTLKEFYD 571 
237786534 605 G-DDGASSAKAETiaR--LGGLKHlvggnletidaRAVNSLhmfddEDGnpIVVRVGRYGPYLertpaGSDEP------- 674 
302877263 564 GfSALIKEKTNIe----rPQELLD-----------EACPEC-----GKP--LAKKLSRYGSFI-----SCTNY------- 609 
91774583  564 GfNNQIHEK---------SNVERPgve-----mldEACPKC-----GKP--LQSRLGRFGKFI-----GCSGY------- 610 
225874955 575 HfEDELKDAATN------MEDIKRmek-----ptdQKCDIC-----GSP--LVLKWGKFGSFY-----ACSAYdkkkkdg 631 
253995662 564 DfNQQIHNK---------ADVERPgne-----lidEACPKC-----GKP--LQKQLSRFGSFI-----GCTGYnd----- 612 
253997957 564 GfNKQLLEKANIDraEitQEDIGE------------ACPKC-----GKP--LHSRLGRFGKFI-----GCSGYp------ 613 
291612476 564 GfNKLISEKKDVdrpgt--------------eileETCPKC-----GKP--LSKRLGKRGSFI-----GCTGYp------ 611 
297537476 564 GfNQQLLSKADV------ERPGNEli--------dEACPKC-----GKP--LQKQLSRFGTFI-----GCTGYnd----- 612 
74316028  553 GfEGDLKAKQDV------ERGCPIl----------EACPKC-----AKP--LFMQASKRGLFI-----GCSGY------- 597 
94970367  572 KfETNLDYAQKH------MENIKRmek-----ptdEKCERC-----GSPl-V-IKWGKHGSFY-----ACSSYd------ 622 
237786534 675 -----QRANLPDTVTpdeldlalaeklLATPPTGRELGEN---PANGRMVVAKEGRYGPYVTelvrdderekaeakalet 746 
302877263 610 -----PECKYKRSVGget-----------qeeVRVELGVH---PESAQAVLLLRGPYGHYVQlge--------------- 655 
91774583  611 -----PECDYIRNPNana-----------nnnEPTVIGQE---PESGKDILLLNGPYGPYLQigl--------------- 656 
225874955 632 ctftkENYEAKPNLA---------------APSDEAEQEEeycENCGRVMVLRNGPWGPFMA------------------ 678 
253995662 613 ----tPKCDYKRSIDg----------tANAGTDPVSIGVD---AATSKEIYLMNGPYGPYLQvgm--------------- 660 
253997957 614 ------ECDYIRNTGs----------nAAASSEPVVMGHD---AASDKDILLLNGPYGPYLQlgl--------------- 659 
291612476 612 ------ECDYTRSLGgeed----------ageSRKELGQH---PDTNQLVLLLRGPYGPYVQlge--------------- 657 
297537476 613 ----ePKCDYKRSLNg----------aAQVGSDPIIIGND---DESGKEIMLMNGPYGPYLQlgl--------------- 660 
74316028  598 -----PECDYTRPLH------------PATAEGDNILGKD---PASGLDVKLLSGRFGPYVQigd--------------- 642 
94970367  623 -----KKDPNSCTFTkenpidl----pdldtaDVQETEQEeycENCGRGMVLKRGRFGQFMA------------------ 675 
237786534 747 vdaewdaddearkaegkkplnretktaakkrekrvnelVTEMLKPKTASLFSGMEPSTVTLDEALKLMSLPR-----EVG 821 
302877263 656 ------------------------------------viEGEKAKPKRVSWPKEMAVDQADLESALKLLSLPK-----DLG 694 
91774583  657 ------------------------------------peADSKKKPKRVSIPKEIPVSSLDMETALKLIALPR-----DLG 695 
225874955 679 --------------------------------------------------CPGYNEDPPCKTVRRLNQKQQQkppqpLDE 708 
253995662 661 ------------------------------------avEGEKKKPKRVSIPKEIALADVNLETANMLLSLPR-----DLG 699 
253997957 660 ------------------------------------peEGSKKKPKRVSIPKEIPLANVDLEVAMKLIALPR-----DLG 698 
291612476 658 ------------------------------------miEGEKTKPKRVSWPKELPLEQADLPSALKLLSLPR-----EVG 696 
297537476 661 ------------------------------------avEGDKKKPKRVSVPKEISLADMNLETAKMVLSLPR-----DLG 699 
74316028  643 -----------------------------------mpeDKKAPKPRRASWPKDIPLENATLDLALKFLSLPR-----EVG 682 
94970367  676 --------------------------------------------------C-TGYPECKTTRRLDQAKKIPDv---pLDE 701 
237786534 822 VDPSDGEVITAQNGRYGPYLKK-------GTDSRSLANEEQIFTITLDEARRIYAEPKRr----------gRAAAKPPLK 884 
302877263 695 LHPETNKKVIVNIGRFGPYIGH-------DGKFKSIPRTDSIFDVTLDRAVELLAQ---------------AKDGNTVLR 752 
91774583  696 QHPETGKKVVANIGRFGPYVNH-------DGKFKSIPKSESVFDIDLARAIELLAQ---------------ANAGAAPIK 753 
225874955 709 KCPKCGEQLVLRHGQYGEFISCsgypkckYIKQNTIGMKCPQCKVGEIVEKKARRGNFFygcseypkcdftANYKPVDRK 788 
253995662 700 LHPETNKKIIANIGRFGPYINH-------DAKFKSIPKNLSVFSIDLDGAVALLAQ---------------AHTGPAPLC 757 
253997957 699 QHPETGKKIVANIGRFGPYVNH-------DGKFKSIPRSDSVFDIDLPRAVELLAQ---------------AKSGPAPLK 756 
291612476 697 AHPETGKKVIVNIGRFGPYIGH-------DGKFKSIPRTDSIFDIGLDRSVELLAQA--------------RSGGATVLR 755 
297537476 700 LHPVTNKKIVANIGRFGPYVNH-------DAKFKSIPKTDSVFTIDLDGAVALLAA---------------AHTGPAPLA 757 
74316028  683 HHPTTGLPIVANNGRFGPYLLH-------DGKFKSIPKTDSVYEIDLPRALEVLAMERApr---------gADSAASVLK 746 
94970367  702 KCPECTRPLVLRHGRFGEFVSC--------SGYPECKWIKQNFVGVKCPQCKEGEIVEKkarrgnffygcaRYPKCDFTS 773 
237786534 885 QLG----DnDVSGKPMTVKEG-RFGPYVTDGETNASLRRGDTPEAMTDARACELLSERrakeaanggAKKKSSKKGTrKS 959 
302877263 753 TLG----DhPVDKTTVEICSG-RYGPYARHGKINATLPKDVSPDEITLEQALELIAAK-------------AAKGDTkPA 814 
91774583  754 ELG----NhPDGTGNIAIYAG-RFGPYVQHGKLRATLPKGQEPETLTMEQALELLSAK--------------------AA 808 
225874955 789 -------C-PECGSAYLMEKTlKSGVYLVC--PNNKKPSAEEETTTKRKKKGDTGEGV---------SCSFTERIGDaPS 849 
253995662 758 SLG----ShPTEDGQIEVFAG-RYGPYVQHGKLRATLPKSIEPESLTMEEALELLSAK----------AAKDAPAKKaPA 822 
253997957 757 DLG----KhPTEDGNIEVYAG-RYGPYVQHGKLRATLPSSEAPEELTMEEALALLAAK---------------AAKEaPA 816 
291612476 756 TLG----EhPDDKAPIEVCSG-RYGPYVRHGKINATLPKDVTPEAVTLEEALEMIAAKaakgg----------tgkakTT 820 
297537476 758 TLG----NhPTEDGQIEVFAG-RYGPYVQHGKIRATLPKSVEPESLTLDEALELLMAK----------AQKEAPAKKtTT 822 
74316028  747 NLG----PhPEDGKDITVRSG-RYGPYVKHGSTNATLPKDITPEAVTLDEAIGLIAAR---------------VAKG-PA 805 
94970367  774 ANKpvaqPcPKCGSEYVLEKKlKSGTYLTCPNNKATASEEPKRRGKKKAAETENAVKCdysvk----------iaepeNT 843 
237786534 960 TKKSGRKSTS----------------KASKKTS--------------------KKSPAKKT 984 
302877263 815 RKSAAKPKAT----------------AKPKAAakp-----------------kaAAKPKAA 842 
91774583  809 KDAPAKKAKT----------------TTAKKTsstkkaatt--------trrkkasaGESE 845 
225874955 850 EAPAATATKP----------------------------------------------AAKPT 864 
253995662 823 KKAAAKKTVA----------------ASEDKPA--------------------AKKAAPKK 847 
253997957 817 KKPAAKKKTT----------------AAKKPAakpaakktt--------atkkpatrAKKT 853 
291612476 821 RKPAAKKAAA----------------KPKTTKekaaakpkttvkkatvktatakttvRKVA 865 
297537476 823 KKPTAKKAPAkkpaaakatakkpaatKTATKKP--------------------AAKKAAVQ 863 
74316028  806 KKPPRKAPTK----------------ASATKT----------------------KAADTAT 828 
94970367  844 DEPEKSADVA--------------------------------------------------- 853 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap