Conserved Protein Domain Family
PRK09293

?
PRK09293: PRK09293 
class 1 fructose-bisphosphatase
Statistics
?
PSSM-Id: 236458
Aligned: 417 rows
Threshold Bit Score: 192.757
Threshold Setting Gi: 55377947
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91777683    4 GRTTLSKFLIDTLDrqpcstetarNAGL-SALLIDVAAAIKSISAMLTKGalggNYGSAQS-INTHGEEQKKLDVATNEI 81 
292655598   1 --MGLMATTDVNTAdta-----raVRTI-DGVVDIIASTAPEIRTGLPGRrv-----tAED-ENPSGETQMAADVFADDL 66 
292656258   1 ------------MTdps-----srEDDVvDAIVETLCAAAPSIRAGLPGRrv-yEEG-----TNPSGERQLEADTYADEL 57 
222480866   1 ------------------------MTET-DPIVEAIFDAVAVTAPEIRAAlp-gRRVESGT-DNPSGESVMAGDLYADEL 53 
289583520   1 ------------------------MTDT-TSAVERVVATVAQTASDIHHGlv-dRRVTADG-ENPSGETQFEADVFADEL 53 
289581972   1 ------------------------MTMS-DPVVEDVVTTVSHSAPEIRRGlv-gRRDAVDE-ENPSGETQVEADIWADEL 53 
76801446    1 -----------------------mADAI-DDIVDVVVSTAPDVRDGLTGRrv------yEAdENPSGERQLEADVYADEL 50 
284164451   1 ------------------------MTVS-DPVVESVVATISRSATEITQGli-gRRGAVDE-ENPSGETQMEADVWADEL 53 
110667835   1 MASSIDSHMTESTAdsesesfsltDDEIiNSILDILARTAPEIRNGLPGRrv-----kTNE-ENPSGESPMEADVFADEL 74 
300711650   1 --------------------msehSDTV-EEVFETVARTAPEIRSALPGRra-eTAG-----KNPSGELRLAADDYADDL 53 
91777683   82 FVQQCEWDGLLAAMVSEEMESVYAIPPgy---prGDYLLAFDPLDGSSNIDINGVVGSIFSVLRngegngnanekngsdp 158
292655598  67 LCERIGALDGVGEYASEERPESVDVGT-------GRLSVAVDPLDGSSNLKPNNTMGTIFAVYDg--------------- 124
292656258  58 LLKRLRPLDGVGEYASEERPDVIDIGE--------GVSVALDPLDGSTNLKPNNVMGTLYSIYDe--------------- 114
222480866  54 LADALTAVDGVGSFVSEEREAAVDAGGgv---geDAYAVAIDPLDGSSNLRSNNAMGTVVGVYDa--------------- 115
289583520  54 LADQLSSIDGVAQYASEERADPVDFAP-------DGLAVAADPVDGTSNLPSNNTMGTVFGIYD---------------- 110
289581972  54 LADRLSSIDGVSQYASEEREAIIDCGRdaa--stDGYTVAVDPLDGSSNLTSNNAMGTIIGVYDa--------------- 116
76801446   51 LEARLLDVDAVGSYASEERESVIEADEg------GRYHVAADPLDGSSNLKSNNTMGTLFGVYEe--------------- 109
284164451  54 LGERLAAIDGVGQYASEERPEAI--DCgedpdssDAYAVAVDPLDGSSNLKSNNAMGTIFGVYDa--------------- 116
110667835  75 LRNRLGSLDGIGEYASEERSSADdt--------gSGLSVCIDPLDGSSNLKSNAAMGTIAAVYDa--------------- 131
300711650  54 LEERLGAIEGVGQYASEETKESVdt--------gEGLAIAVDPLDGSSNLKPNNTMGTIVGIYNa--------------- 110
91777683  159 rgtvgeSAFLRPGCEQVAAGYAVYGPSTMLVLSVGNGTHGFTLEREIGn---FVLTHSNIRIPEDTVEFAiNaSNERFWE 235
292655598 125 -------pLPAHGRDLVAAGYVLYGPVMTMIVARNGTVDEYVLHDDAS----HELVREDVSLPDEGSVYGfG-GRVPDWT 192
292656258 115 -------pLPTGGENLLAAGYILYGPVTTLVAGRDGVVSEYILESGIK-----RPLREELTLPGDPAIFSfG-GRVNRWF 181
222480866 116 -------pLPATGRDLVAAGYVLYGPITTMIVADDDGVREEVVEGDGDggvsRSVVEDDLRLPEDPLVYGfG-GRVPDWP 187
289583520 111 ------ASLPAPGTALVAAGYVLYGPLTTMMVAHDGTVTEYALVDGDRt-----VIRDDVTIPATPTVYGfG-GRVPTWI 178
289581972 117 -------pLPARGENLVAAAYVLYGPITTMLLATEDTVSEYELTD--Gn---HRRIREDITLPDDPVVYGfG-GRVPDWT 183
76801446  110 -------pLPAAGDALVAAGYVLYGPITTLITARDGTVTESVIDED-Gt---RTVVTDDLTLPSDPVVYGfG-GRVPNWT 177
284164451 117 -------aLPAPGEDLIAAGYVLYGPITTMVIATEETVSEYEMTGGERr-----LIERDVTLPDEPVVYGfG-GRVPDWP 183
110667835 132 -------pLPARGSDLVAAAYVLYGATTTMIAAVEGNVADYVIYQD-Gs---YEPIEQEVRVPSEPTVYGfG-GRVPNWP 199
300711650 111 -------pLPAAGHELVGATYVLYGPITTMAAAAEGEVTEYVVTDGERe-----AVREDLTLPEDPAVYGfG-GRVPDWT 177
91777683  236 PPVRRYVqeckdgrsgcRASDFNM--RWIASMVAEVHRILMRGGVFMYPRDskTPAMEGRLRLLYEANPMSFLVEQAGGL 313
292655598 193 DDFEAFAre------veQDASRKL--RYGGSMIGDVNQILTYGGIFAYPTL--ESAPEGKLRVQFEGYPIGYVIETAGGA 262
292656258 182 DDFEAFAre------teRTEGMKL--RYGGSMIGDVNQILHYGGVFAYPAQ--TDAPGGKLRQQFEGFPIGYIIECAGGR 251
222480866 188 DDFTAYAr--------eIEDELKL--RYGGAMVGDVNQVLTYGGIFAYPAL--VDAPDGKLRLSFEANPIAYIVEKAGGA 255
289583520 179 DDFHEFArgi----etdDELALEC--HYSGAMINDVNQVLTKGGIFAYPAL--ENSPNGKLRLQFEGNPIGYIIETAGGR 250
289581972 184 DEFTEYAr--------tIETELKR--RYGGAMIGDVNQVLTYGGIFGYPGL--ESRPEGKLRLQFEGNPVGYIVEQAGGR 251
76801446  178 PAFADYVe--------sVASELKL--RYGGAMIGDVNQVLTYGGVFGYPGL--EDRPEGKLRLLFEGHPIAAIVEAAGGA 245
284164451 184 ADFESYA----------REIENELklRYGGAMIADVNQVLTYGGVFAYPSL--ESSPEGKLRLQFEGNPIGYIVERAGGR 251
110667835 200 RDFNSFVsd------ieSDTSMKL--RYGGAMVGDVNQVLTYGGIFGYPAL--TNAPSGKLRVQFEGYPIGYIIECAGGA 269
300711650 178 EDFAAYVee------ieSDESLRL--RYGGSMIGDVNQVLTYGGIFAYPAL--ESAPEGKLRLQFEGNPVGYIVETAGGR 247
91777683  314 SITGRERILDVVP-RALHGRVPVILGSKHEVERIGRYHGEYD 354
292655598 263 TSDGTKSLLDVDK-DGLHARTPMYVGNTELVAKLEAALD--- 300
292656258 252 SSDGEQSLLSGTP-EDIHDRVPVYIGNDSLVESLETRLD--- 289
222480866 256 ASNGETDILDVES-EGVHDRIPLYVGNEALVERLEDALANE- 295
289583520 251 SSDGSRSILDVEP-TDLHDRVPLHVGNPELVERLEAAIG--- 288
289581972 252 SSNGEQSLLTVDPsDDIHERTPVFVGNESLIDRLEMQLS--- 290
76801446  246 SSDGDGSLLKKEP-EQLHERTPLFVGNDEYIERLEAALP--- 283
284164451 252 SSNGDESLLSVEP-DALHDRTPVHVGNADLIDRLEETLE--- 289
110667835 270 SSDGSQSLLAVES-NDIHDRTPVYVGTPSLVERLEGALAGKA 310
300711650 248 SSDGEGSILEVDP-EDLHERVPVYVGSTDLIDRLEGALN--- 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap