Conserved Protein Domain Family
PRK10263

?
PRK10263: PRK10263 
DNA translocase FtsK; Provisional
Statistics
?
PSSM-Id: 236669
View PSSM: PRK10263
Aligned: 54 rows
Threshold Bit Score: 2192.56
Threshold Setting Gi: 296103104
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218553476    1 MSQEYTEDKEVTLTKLSSGRRLLEALLILIVLFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGMPGAWLADTLFFIFG 80  
146311071    1 MSQEYTEDKEVTLTKLSSGRRLLEALLILVALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGVPGAWLADTLFFVFG 80  
224582770   20 LSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 99  
197249671    1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
29142396     1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
16759831     1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
16764321     1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
194445292    1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
62179484    20 LSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 99  
194735560    1 MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGAPGAWLADTLFFIFG 80  
218553476   81 VMAYTIPVIIVGGCWFAWRHQSSDEYIDYFAVSLRIIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
146311071   81 VMAYTIPVIIVGGCWFAWRHRQNEDYIDYFAVSLRLIGALALILTSCGLAAINADDIWYFASGGVIGSLLSTALKPMLHS 160 
224582770  100 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 179 
197249671   81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
29142396    81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
16759831    81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
16764321    81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
194445292   81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
62179484   100 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 179 
194735560   81 VMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHS 160 
218553476  161 SGGTIALLCVWAAGLTLFTGWSWVTIAEKLGGWILNILTFASNRTRRDDTWVDED--EYEDDEEYEDENHGKQHESRRAR 238 
146311071  161 SGGTITLLCIWAAGLTLFTGWSWVSIAEKLGNFILNILTFASNRTRRDDTWVDEDeyEYEDDDDQEASSTADRRESRRTR 240 
224582770  180 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESSRAR 255 
197249671  161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
29142396   161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
16759831   161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
16764321   161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
194445292  161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
62179484   180 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 255 
194735560  161 SGGTIMLLCIWAAGLTLFTGWSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDE--EYDD--EYDEETDGVQRESRRAR 236 
218553476  239 ILRGALARRKRLAEKFINPMGRQTDAALFSGKRMDDDEEIIYTARGVAADPDDVLFSGNRATQPEYDEYDPLLNGAPITE 318 
146311071  241 IMRGALERRKRVAEKFTNPLGRKTDAALFSGKRMDDEEHVEYSAAGVAADPDDVLFSGRRAMPGDYDEYDPLLNGQSVTA 320 
224582770  256 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQPEYDEYDPLLNGHSVTE 335 
197249671  237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQPEYDEYDPLLNGHSVTE 316 
29142396   237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQSEYDEYDPLLNGHSVTE 316 
16759831   237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQSEYDEYDPLLNGHSVTE 316 
16764321   237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQPEYDEYDPLLNGHSVTE 316 
194445292  237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQPEYDEYDPLLNGHSVTE 316 
62179484   256 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDALFSGNRATQPEYDEYDPLLNGHSVTE 335 
194735560  237 ILRGALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQPEYDEYDPLLNGHSVTE 316 
218553476  319 PVAVAAAATTATQSWAAPVEPVTQTPPVASVDVPPSQPTVAWQPVPGPQTGEPVIAPAPEGYPQQSQYAQPAVQYNEPLQ 398 
146311071  321 PIAAAAIATTAAQVYAAPVEAVTPSAPVLTADTDLQQPIIDWQTAPGVHTPEPSIAPQPESYTPAP--------HQEHWQ 392 
224582770  336 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 415 
197249671  317 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
29142396   317 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
16759831   317 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
16764321   317 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
194445292  317 PVAAAAAATAVTQTWAAPADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
62179484   336 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 415 
194735560  317 PVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQPVPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQ 396 
218553476  399 QPVQpqqpyyapaaeqPAQQPYYAPAaeqpvQQPYYAPAPEQPvagnAWQAEEQQSTFAPQSTYQTEQTYQ-QPAaQEPL 477 
146311071  393 QPY-------------------------------------------------QPDSLYEPQAYQQFEQPVV-QPVvQPYQ 422 
224582770  416 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQPEPTHQPEPVYQpEPIaAEPS 479 
197249671  397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQPEPTHQPTPVYQpEPIaAEPS 460 
29142396   397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQP------------EPIaAEPS 448 
16759831   397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQP------------EPIaAEPS 448 
16764321   397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP-------------QWQPEPTHQPTPVYQpEPIaAEPS 451 
194445292  397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQPEPTHQPEPVYQpEPIaAEPS 460 
62179484   416 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQPEPTHQPEPVYQpEPIaAEPS 479 
194735560  397 QPVP------------VASAPQYAATpataaEYDSLAPQETQP----QWQAPDAEQHWQPEPTHQPTPVYQpEPIaAEPS 460 
218553476  478 YQQPQSVEQ-QPVVEPEPVVEETKPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKEPEPIKSSLKApsVAAVPPVE 556 
146311071  423 EHAPEYVEPaQDYVEPVPEVEETKPSRPPMYYFEEVEERRAREREQLAAWYQPVPEPAKEP----ASTPAfsPSVASGMG 498 
224582770  480 HMPPPVIEQ-PVATEPEPNTEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKSTVSV--APSIPPVE 556 
197249671  461 HMPPPVIEQ-PVTTEPEPDTEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKDNVPVKPTVSV--APSIPPVE 537 
29142396   449 HMPPPVIEQ-PVATEPEPGIEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSV--APSIPPVE 525 
16759831   449 HMPPPVIEQ-PVATEPEPGIEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSV--APSIPPVE 525 
16764321   452 HMPPPVIEQ-PVATEPEPDTEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSV--APSIPPVE 528 
194445292  461 HMPPPVIEQ-PVATEPEPDTEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSV--APSIPPVE 537 
62179484   480 HMPPPVIEQ-PVATEPEPNTEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKSTVSV--APSIPPVE 556 
194735560  461 HMPPPVIEQ-PVATEPEPVIEETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSV--APSIPPVE 537 
218553476  557 AAAAVSPLASGVKKATLATGAAATvAAPVFSLANSGGPRPQVKEGIGPQLPRPKRIRVPTRREL--ASYGIKLPSQRAAE 634 
146311071  499 SASTVAPVAAGVQQATSHATTAAGvAAPVFNLAAGAAPRPQVKEGIGPQLPRPNRVRVPTRRELasASFGIKIPSQQISE 578 
224582770  557 AVAAAASLDAGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 632 
197249671  538 AVAAAASLDAGIKSGTLAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 613 
29142396   526 AVAAAASLDTGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 601 
16759831   526 AVAAAASLDTGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 601 
16764321   529 AVAAAASLDAGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 604 
194445292  538 AVAAAASLDAGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 613 
62179484   557 AVAAAASLDAGIKSGALAAGAAA--AAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 632 
194735560  538 AVAAAASLDAGIKSGALAAGAAA--AAPAFGLATGGAPRPQVKEGIGPQLPRPNRVRVPTRREL--ASYGIKLPSQRIAE 613 
218553476  635 EKAREAQRNQYDSGDQYNDDEIDAMQQDELARQFAQTQQQRYGEQYQHDVPvNAEDA--DaAAEAELARQFAQTQQQRYS 712 
146311071  579 ERMAEEDY-----------DDAEEMHQDELARQFAAQQNQRYGEEHQHDAShYPAQDceDdAAEVELARQFAATQQQRYS 647 
224582770  633 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 709 
197249671  614 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 690 
29142396   602 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 678 
16759831   602 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 678 
16764321   605 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 681 
194445292  614 EKAREAERNQYETGVQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 690 
62179484   633 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 709 
194735560  614 EKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQ-QAEDD--DtAAEAELARQFAASQQQRYS 690 
218553476  713 GEQPAGANPFSLDDFEFSPMKALLDDGPHEPLFTPIVEPVqqpqqpvapqqqyqq---pqqpvppqqqyqqpqQPVAPQQ 789 
146311071  648 GDQPSGANAFSLSDFEFSPIKDLIDDTPSAPLFTPSVMPE---------------------------------------- 687 
224582770  710 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqyqq--pqqpvapqpqyqqpqQPVASQP 787 
197249671  691 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqpqyqqpqqpvapqpqyqqpqQPVAPQP 770 
29142396   679 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqy-----qqpvapqpqyqqpqQPVASQP 753 
16759831   679 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqy-----qqpvapqpqyqqpqQPVASQP 753 
16764321   682 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqpqyqqpqqpvapqpqyqqpqQPVAPQP 761 
194445292  691 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqpqyqqpqqpvapqpqyqqpqQPVAPQP 770 
62179484   710 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMPEstpvqqpvapqpqyqq--pqqpvapqpqyqqpqQPVASQP 787 
194735560  691 GEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPSVMPEstpvqqpvapqpqyqq--pqqpvapqpqyqqpqQPVAPQP 768 
218553476  790 QYQQPQQPVPPQQQYqqpqqpvapqpqyqqpQQQVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqpvaPqqQD 869 
146311071  688 -QEQPRQSFAPpqq--------------qhvQQPVA-------PQQPAVAPPQYAQHQPSPAQA--------------QE 731 
224582770  788 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 865 
197249671  771 QYQQPQQPTAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 848 
29142396   754 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 831 
16759831   754 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 831 
16764321   762 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 839 
194445292  771 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 848 
62179484   788 QYQQPQQPVAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPVALQPQYQQPQQPVAPQpqyqqpqqptaP--QD 865 
194735560  769 QYQQPQQPIAPQPQYqqpqqpvapqpqyqqpQQPVAPQPQYQQPQQPTAPQPQYQQPQQPVAPQpqyqqpqqptaP--QD 846 
218553476  870 TLLHPLLMRNGDSRPLHKPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 949 
146311071  732 SLIHPLLMRNGDSRPVQRPTTPLPSLDLLTSPPSEVEPVDTFALEQMARLVETRLADFRIKADVVNYSPGPVITRFELNL 811 
224582770  866 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 945 
197249671  849 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 928 
29142396   832 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 911 
16759831   832 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 911 
16764321   840 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 919 
194445292  849 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 928 
62179484   866 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 945 
194735560  847 SLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNL 926 
218553476  950 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPV 1029
146311071  812 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTIVLGKDIAGEPV 891 
224582770  946 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 1025
197249671  929 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 1008
29142396   912 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 991 
16759831   912 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 991 
16764321   920 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 999 
194445292  929 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 1008
62179484   946 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 1025
194735560  927 APGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPV 1006
218553476 1030 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCV 1109
146311071  892 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKVQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 971 
224582770 1026 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1105
197249671 1009 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1088
29142396   992 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1071
16759831   992 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1071
16764321  1000 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1079
194445292 1009 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1088
62179484  1026 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1105
194735560 1007 VADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSV 1086
218553476 1110 NEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWKPGDSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEEL 1189
146311071  972 NEMERRYKLMSALGVRNLAGYNDKIAEAARMGRPIPDPYWKPGDSMATEHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1051
224582770 1106 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1185
197249671 1089 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1168
29142396  1072 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1151
16759831  1072 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1151
16764321  1080 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1159
194445292 1089 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1168
62179484  1106 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1185
194735560 1087 NEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPVLEKLPYIVVLVDEFADLMMTVGKKVEEL 1166
218553476 1190 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRV 1269
146311071 1052 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTTPVRV 1131
224582770 1186 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1265
197249671 1169 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1248
29142396  1152 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1231
16759831  1152 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1231
16764321  1160 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1239
194445292 1169 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1248
62179484  1186 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1265
194735560 1167 IARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRV 1246
218553476 1270 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGA-GGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYN 1348
146311071 1132 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSESESEGGGsGGYDGAEELDPLFDQAVNFITEKRKASISGVQRQFRIGYN 1211
224582770 1266 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1344
197249671 1249 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1327
29142396  1232 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1310
16759831  1232 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1310
16764321  1240 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1318
194445292 1249 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1327
62179484  1266 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1344
194735560 1247 HGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGG-GGFDGGEELDALFDQAVNFVTQKRKASISGVQRQFRIGYN 1325
218553476 1349 RAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD 1381
146311071 1212 RAARIIEQMEAQGIVSEPGHNGNREVLAPPPFE 1244
224582770 1345 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1377
197249671 1328 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1360
29142396  1311 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1343
16759831  1311 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1343
16764321  1319 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1351
194445292 1328 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1360
62179484  1345 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1377
194735560 1326 RAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE 1358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap