Conserved Protein Domain Family
PRK10760

?
PRK10760: PRK10760 
murein hydrolase B; Provisional
Statistics
?
PSSM-Id: 236754
View PSSM: PRK10760
Aligned: 99 rows
Threshold Bit Score: 583.624
Threshold Setting Gi: 53803830
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242240641  15 MRRLIAV--VPLLVMLSACSNTPSESQPDamitgtpsSTSPTP-------------TGGfF-----NPGaq-sGMLANGD 73 
116052476   1 MRRTALA--LPLFLLVSACSSEPTPPPKP--------AAKPQArtvi-----tprpVRQ-S-----VQP----ILPLRGD 55 
15599640    1 MRRTALA--LPLFLLVSACSSEPTPPPKP--------AAKPQArtvi-----sprpVRQ-S-----VQP----ILPLRGD 55 
152984661   1 MRRTALA--LPLFLLVSACSSEPTPPAKP--------AAKPQArsvi-----spqpVRR-S-----VQP----ILPLRGD 55 
218893535   1 MRRTALA--LPLFLLVSACSSEPTPPPKP--------AAKPQArtvi-----sprpVRQ-S-----VQP----ILPLRGD 55 
117618194   1 MRRLVSVltLSLFPMLYGCSSTPAAKPVV--------KPQPNSafinqtppskpfyGQvs------------qPGVSKGD 60 
145299737   1 MRRLVSVltLSLFPLLYGCSSTPAPKPVAkp------------------------fKSAfInqtpqIKPay-sQGVSKGD 55 
50120023    1 MRHLVRF--LPLLVLLSACSSQPAPPPTE--------APSGnp------------fNGGfL-----LEPah-nVHPLGGD 52 
271499289   1 MRRLVAV--LPLLLALSACSNKSAEPAGA--------EIIGTPpss--------apSGGfL-----LSPghsgGLLTNGD 57 
251790906  15 MRRLVAV--FPLLLALSACSNKSTEPAGA--------EIIGTPaan--------apSGGfL-----LSPahagAMLTNGD 71 
242240641  74 FANSPDVDRFIGKMAQQYGFDRQQLHTILGQAQRLDWVIRLMDKQAPAPstAVPSNiPNGAWLRYRKQFITPDNLQNGVA 153
116052476  56 YANNPAAQRFIDRMVSQHGFNRQQLHDLFAQTQRLDWVIRLMDRQAPTY--TPPSG-PNGAWLRYRKKFVTPGNVQNGVL 132
15599640   56 YANNPAAQHFIDRMVSQHGFNRQQLHDLFAQTQRLDWVIRLMDRQAPTY--TPPSG-PNGAWLRYRKKFVTPGNVQNGVL 132
152984661  56 YANNPQAQRFIDRMVSQHDFNRQQLHDLFAQTQRLDWVIRLMDRQAPSY--TPPSG-PNGAWLRYRKKFVTPGNVQNGVL 132
218893535  56 YANNPAAQRFIDRMVSQHGFNRQQLHDLFAQTQRLDWVIRLMDRQAPTY--TPPSG-PNGAWLRYRKKFVTPGNVQNGVL 132
117618194  61 FANRANVDNFVQRMVQKHGFDGAELHRVLAQAERYDWIIRLMDAQAPTT--TPPTG-PTGAWNRYRAKFITPDNVQNGVS 137
145299737  56 FANRNNVDSFVQRMVEKHGFDSVELHRLLAQADRYDWIIRLMDAQAPTT--AKPIG-PTGAWNRYRAKFITPDNVQNGVN 132
50120023   53 FATNAATARFVDKMVQEHGFNRQQLHDVLVQAKSLDWVIRLMDKQAPTS--RPPSG-PNGAWNRYRNQFITPDNVQNGVA 129
271499289  58 FANSPDVDRFVDKMVRQYGFERQQLHDVLAQAQRLDWVIRLMDKQAPAPstATPSNiPNGSWLRYRKQFITPDNVQNGVA 137
251790906  72 FANSPEVNRFVDKMVQQHGFERQQLHDVLAQAQRLDWVIRLMDKQAPAPstATPSNiPNGAWLRYRKQFITPDNLQNGVA 151
242240641 154 FWNQYADALERARQIYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLAFAYPRRAEYFQSELEYFLLMAREDGFDPLS 233
116052476 133 FWDQYETDLQRASRVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALSTLSFSYPRRAEFFSGELEQFLLQARKEGTDPLA 212
15599640  133 FWDQYETDLQRASRVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALSTLSFSYPRRAEFFSGELEQFLLQARKEGTDPLA 212
152984661 133 FWDQYQADLQRASRIYGVPPEIIVGIIGVETRWGRVMGKTRIIDALATLSFSYPRRAEFFSGELEQFLLQARKEGSDPLA 212
218893535 133 FWDQYETDLQRASRVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALSTLSFSYPRRAEFFSGELEQFLLQARKEGTDPLA 212
117618194 138 FWREYENELNRAQQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLAFDYPRRAEFFTSELESFLVMTRDEGMDPTE 217
145299737 133 FWREYESELNRAEQEYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLAFDYPRRAEFFTGELEAFLVMTRDEGMDPTE 212
50120023  130 FWNQYQDALQRAQNIYGVPPEIIVGIIGVETRWGRVMGKTRIIDALATLAFDYPRRADYFAGELETFLLMARKEGNDPLS 209
271499289 138 FWNQYQDALARAQQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFAYPRRAEYFQSELEYFLLMAREDGFDPLS 217
251790906 152 FWNQYQDALARAQQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLAFAYPRRAAYFQSELEYFLLMAREDGFDPLS 231
242240641 234 LRGSFAGAMGYGQFMPSAFKKYAVDFNGDGIPNLWDPVDAIGSVANYFKSNGWQPNEQIAVPASGQTFSLDTGFKTRYSL 313
116052476 213 LRGSYAGAMGYGQFMPSSFTKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVNGDRVAVPASGRAPSLEDGFKTLYPL 292
15599640  213 LRGSYAGAMGYGQFMPSSFTKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVSGDRVAVPASGRAPSLEDGFKTLYPL 292
152984661 213 LRGSYAGAMGYGQFMPSSFSKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVSGDRVAVPASGRAPSLEDGFKTLYPL 292
218893535 213 LRGSYAGAMGYGQFMPSSFTKYAVDFDGDGHIDLWNPRDAIGSVANYFKQHGWVNGDRVAVPASGRAPSLEDGFKTLYPL 292
117618194 218 PKGSYAGAMGYGQFMPSSFQRYAVDFNGNGHTNLWDPVDAIGSVANYFKAHGWEKGQPVAVRGQGQLPGYEHGFQTRYPV 297
145299737 213 PKGSYAGAMGYGQFMPSSFQRYAVDFDGNGHTNLWDPVDAIGSVANYFKAHGWEQGQPVAVRGQGQLPGYEHGFQTRYPI 292
50120023  210 LRGSYAGAMGYGQFMPSSFKNYAVDFDGNGHTNLWDPVDAIGSVANYFKAHGWVKGAPVAVPANGQAPLLPNGFNTRYSL 289
271499289 218 LRGSFAGAMGYGQFMPSAFKKYAVDFNGDGIANLWDPVDAIGSVANYFKSNGWQPNQQVAITASGQTFSLETGFKTRYSL 297
251790906 232 LRGSFAGAMGYGQFMPSAFKKYAVDFNGDGIANLWDPVDAIGSVANYFKSNGWQPDGQVAVTASGQTFALETGFKTRYSV 311
242240641 314 STLAAAGLRPTASLGGYQEASLLRLDMGSYYQFWYGLPNFYAITRYNHSVHYAMAVWQLGEEVRKARQG 382
116052476 293 DVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKEVDRVRHR 361
15599640  293 DVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKEVDRVRHR 361
152984661 293 DVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKAVDQARHG 361
218893535 293 DVLASAGLRPQGPLGGHRQASLLRLDMGRNYQYWYGLPNFYVITRYNHSTHYAMAVWELGKEVDRVRHR 361
117618194 298 ASLRRAGLTPTSTLGNHSEASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGLAVKDARGG 366
145299737 293 TTLHRAGLNPISNLGNHSEASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGLAVKAARGG 361
50120023  290 TELQAAGLTPQHSLAGYSEASLLRLDIGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGEAVGRAR-- 356
271499289 298 STLAAAGLRPTASLGGYQEASLLRLDMGSYYQFWYGLPNFYAITRYNHSVHYAMAVWQLGEEVRKARQG 366
251790906 312 STLAAAGLRPTASLGGAQEASLLRLDMGSYYQFWYGLPNFYAITRYNNSVHYAMAVWQLGDEVRKARQG 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap