Conserved Protein Domain Family
PRK11281

?
PRK11281: PRK11281 
mechanosensitive channel MscK
Statistics
?
PSSM-Id: 236892
Aligned: 122 rows
Threshold Bit Score: 1354.97
Threshold Setting Gi: 217968625
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197284047    7 FIRLNHF-ISTI--FIVSILFVLLGNILFTPAKAEtVSnnLPTKESIQNQLNLLNKRSDLSAEDKLTIGDLEQALLLLDN 83  
251792160    1 ---MKIS-YFLTalCAAFVLNVAVSQSAFADQNN--NA--LPTEKSLKADLAAANKIAD-SDEKKALIDSLQTSLDLLQQ 71  
68248800     6 MKTPPFFtVL----FASAMFTLSVSQGALGANSTNv----LPTEQSLKADLANAQKMSEGEAKNTLL-AELQTSIDLLQQ 76  
165976165    1 --------------MIKRLFNPFLLGLMFVLSGNHlWAaeLPTEKDLKAQIDAAKKGEQ-NEGNKALIQHLENTQALLTQ 65  
152978639    7 TRRVATQ-------LLLSVLLIAVLP---QAAYSA-----LPSAREIENQLEKAKQAEQTDEVSKNLVKDLEATQRFISD 71  
190150062    1 --------------MIKRLFNPFLLGLMFVLSGNHlWAaeLPTEKDLKAQIDAAKKGEQ-NEGNKALIQHLENTQALLTQ 65  
148827334    1 ----MKIpPFFTalFASAMFTLSVSQGVLAANSTNv----LPTEQSLKADLANAQKMSEGEAKNRLL-AELQTSIDLLQQ 71  
126208228    1 --------------MIKRLFNPFLLGLMFVLSGNHlWAaeLPTEKDLKAQIDAAKKGEQ-NEGNKALIQHLENTQALLTQ 65  
52424920     4 IRIIRSF-GLAL--SLVFAFVGSTFA----------AD--LPTEKSLQAQIEQLQKDEQTEVNKALV-QNLQDAQELLAQ 67  
261868275    1 -MKINAF-LTAL--CVALLLNVAVSQSAFADQNNA-----LPTEKSLKADLANAQKLPD-GDEKKTLVADLQTSLDLLQQ 70  
197284047   84 IQQLEKKADDYNKTVEQLPEKLRSIQNQLSQLKQkiANKEVDdyRQSLESLPLATLESQLEEVLQSLAKAQEDLANYSNE 163 
251792160   72 IQAQQKSNEALQNTINGADAEIQKNNSELQNLKK--QLNTAK--AEDYQSRSLADLQAQLEKLTNQQQETQAALSVANSQ 147 
68248800    77 IQAQQKINDALQTTLSHSESEIRKNNAEIQALKKq-QETATS---TDYNAQSQDDLQNSLAKLNDQLQDTQNALGAANAQ 152 
165976165   66 ITKQKADNEALDKEIEQAQASLKASQANVNKLKN--TNLSTL---ETLAKRSMAELQKELADVQVAGESVQQELTTINAK 140 
152978639   72 IAKQKEQNAKLVKSIENADKGIATSQTNIAKLKA--DKLPTV---TELSKYSLKELQQKLEQKQIALQRVQEALAQVNTD 146 
190150062   66 ITKQKADNEALDKEIEQAQASLKASQANVNKLKN--TNLPTL---ETLAKRSMAELQKELADVQVAGEFVQQELTTINAK 140 
148827334   72 IQAQQKINDALQTTLSHSESEIRKNNAEIQALKKq-QETATS---TDDNAQSQDYLQNSLTKLNDQLQDTQNALSTANAQ 147 
126208228   66 ITKQKGDNEALDKEIEQAQASLKASQANVNKLKN--TNLSTL---ETLAKRSMAELQKELADVQVAGESVQQELTTINAK 140 
52424920    68 IAKQKADNEKLNKDIDRSTRTLAESKANIERFKKqeKTVEQL--KEDFRKLSLTTLQDRSESATENLQNLQAELLTLNAN 145 
261868275   71 IQAQQKANDELQATINGADAEIQKDSTDLQNLKK--QLNTAS--ADDYKSATLTSLQSAFEKLNAQQQDTQAALNVANGL 146 
197284047  164 LIVLQTQPERAQSVLFNNSERLQQIRIALNKSSADKaqmrsSSVQLLQLEQYYLQQQNSFQKRTLQSNVQLQSLLQLQRD 243 
251792160  148 LAGQSSVSERAQTTLTANLKRTQELNQKLSNSGISS-----VLKQQYQLELQLIDLKNTYNQILLKNSDQLTVLYQSRYD 222 
68248800   153 LAGQNSISERAQAALTENVVRTQQINQQLANNDIGS-----ALRKQYQIELQLIDLKNSYNQNLLKNNDQLSLLYQSRYD 227 
165976165  141 LVTQNSAPDKAQTTLTSNATRKQEIATLLGNVNISG-----AEKIKLETELVLLDLQNSYSQSLLRGSDNLTALYNSQLD 215 
152978639  147 LVSQRSSPERAQKILTENAKRTQAINQVLIDDNLAK-----SRKMRLEAEQALLDLQNSYNQTLLQGTTRLTSLYSLIVE 221 
190150062  141 LVTQNSAPDKAQTTLTSNATRKQEIATLLGNVNISG-----AEKIKLETELVLLDLQNSYSQSLLRGSDNLTALYNSQLN 215 
148827334  148 LAGQSSISERAQAALTENVVRTQQINQQLANNDIGS-----ILRKQYQIELQLIDLKNSYNQNLLKNNDQLSLLYQSRYD 222 
126208228  141 LVTQNSAPDKAQTTLTSNATRKQEIATLLGNVNISG-----AEKIKLETELVLLDLQNSYSQSLLRGSDNLTALYNSQLD 215 
52424920   146 LSGQKTAPERAQAALTENLKQSQALNSQLSNVNIEK-----TLQTKLTAQLALLELKNAYNQILLYGNNALTNLYTSQVN 220 
261868275  147 LAGQSSVSERAQTALATNLKRTQELNQKLAESSTSS-----TLKQQYQLELQLIELRNANNQFLLKNSDQLTVLYKNRYD 221 
197284047  244 YSSAYIDLSQEHAQLLQEILSDKRLDSSEEVAKEA-QTAELSNQaIKNNAFYLAQADINKKLSDKLIITTQNNNELNRHS 322 
251792160  223 LLSVRVQVQQQQLAVIQEVINQKNLEQTQNQVDQVqQQSQNAVK----NEFIQKELERNAQLSKYLLEQTEKTNTLTQDE 298 
68248800   228 LLNLRLQVQQQNIIAIQEVINQKNLQQSQNQLEQAqQQQQKTVQ----NDYIQKELDRNAQLGQYLLQQTEKANSLTQDE 303 
165976165  216 EKKLAQQNLQSELSNLQNAINTKLVEESKNKVEQAaESQQKNAN-SDTNPLIVKELNFNTRISEELLKQTTQLTQLSQDN 294 
152978639  222 ERTLQQQQLQSELNTLQSAINEKNLQLSREQVEQAtQNQEKNAE-ANANPVVAAQLNFNTQISKGILEETAQMNSLSQDN 300 
190150062  216 EKKLAQQNLQSELSNLQNAINTKLVEESKNKVEQAaESQQKNAN-SDTNPLIVKELNFNTRISEELLKQTTQLTQLSQDN 294 
148827334  223 LLNLRLQVQQQNIIAIQEVINQKNLQQSQNQVEQA-QQQQKTVQ----NDYIQKELDRNAQLSQYLLQQTEKANSLTQDE 297 
126208228  216 EKKLAQQNLQSELSNLQNAINTKLVEESKNKVEQAaESQQKNAN-SDTNPLIVKELNFNTRISEELLKQTTQLTQLSQDN 294 
52424920   221 EKTLEQTQLQKQLTALQDIINEKNLEKTQEQVEKAtESQQKSAA-TNTNPVIVRELDLNTAVTKDLLEQTTKLNALSQDN 299 
261868275  222 LLSVRVQVQQQQLALIQEVINQKNLVQSQNQVEQAqQQQQSAVK----NNFIQQELERNAQLSRFLLEQTEKTNTLTQDE 297 
197284047  323 LMVKNRLDRAIQSERNLKEQIDVLKGSLLLSRILFEEQIELPDDIFINKLPDKIADLRLEQFEINKQRDQIFQPNLYIDQ 402 
251792160  299 LRMRNVLDNLTQTQRTIDDQISSLQGTLVLSRIIQQQKQKLPTNLNIQGLSKQIADLRVQIFDITQKRNELYDLDSYIEK 378 
68248800   304 LRMRNILDSLTQTQHTIDEQISALQGTLVLSRIIQQQKQKLPTNLNIQGLSKQIADLRVHIFDITQKRNELYDLNNYINK 383 
165976165  295 LRIKSVLDNLQQTQRNIEEQISALQGTLVLSRIINKQKQSLPQDQMIKGLSKQIADLRVRVFDITEFKDSVSEPAIYIAK 374 
152978639  301 LRIKNVLDNLQQTQRNIEEQISSLQGTLVLSRIINKQRQSLPQDKMISGLGKRIADLRVKIFDITEFRDKLYDTDEYIKD 380 
190150062  295 LRIKSVLDNLQQTQRNIEEQISALQGTLVLSRIINKQKQSLPQDQMIKGLSKQIADLRVRVFDITEFKDSVSEPAIYIAK 374 
148827334  298 LRMRNILDSLTQTQRTIDEQISALQGTLVLSRIIQQQKQKLPTNLNIQGLSKQIADLRVHIFDITQKRNELYDLDNYINK 377 
126208228  295 LRIKSVLDNLQQTQRNIEEQISALQGTLVLSRIINKQKQSLPQDQMIKGLSKQIADLRVRVFDITEFKDSVSEPAIYIAK 374 
52424920   300 LRVKGILDNLQQTQHNIEEQISALQGTLVLSRIINKQQQSLPQDSMIKGLPKQIADLRVKIFDITEFKNNVNNAPAYIAS 379 
261868275  298 LRMRNVLENLTQTQRTIDEQISALQGTLVLSRIIQQQKQKLPTNLNIQGLSKQIADLRVQIFDITQRRNELYDLDAYITK 377 
197284047  403 LMQeYQAAHpeitdknELKELHNALLQLIDARRDLLDKLNNQLGSQISESINLQMDQQQLRSVVSSLENTLAQQIFWVSS 482 
251792160  379 IQQ-DENQT-------FSATEKAQFTNLLIERRKILSDLIKSLNNQLNLAISLELTQQQITQISDQIQSKLDQQSFWVKS 450 
68248800   384 VES-EDGKQ-------FTEAERTQVKTLLTERRKMTSDLIKSLNNQLNLAISLELTQQQITQISDQIQSKLEQQSFWVKS 455 
165976165  375 LEK-DEKTT-------FTDKEKEQLKSILTERAKILAELIKSLNNQLNLSINIELNQQQVQTISDSLQKKLEQQSFWVKS 446 
152978639  381 LEQ-TEKIS-------FSAKDRAQLIDLVEERRKLLADYLSLLNNQLNLSINIELNQQQVQSISDSLQNKLQQQSFWVKS 452 
190150062  375 LEK-DEKTT-------FTDKEKEQLKSILTERAKILAELIKSLNNQLNLSINIELNQQQVQTISDSLQKKLEQQSFWVKS 446 
148827334  378 VES-EDGKQ-------FTEAERTQVKTLLTERRKMTSDLIKSLNNQLNLAISLELTQLQITQISDQIQSKLEQQSFWVKS 449 
126208228  375 LEK-DEKTT-------FTDKEKEQLKSILTERAKILAELIKSLNNQLNLSINIELNQQQVQTISDSLQKKLEQQSFWVKS 446 
52424920   380 LEK-SDKVT-------FTDAEKNQLTDILAARDKVLTDLLKQLNGQLNVSINLELNQQQVQTISDALQSKLKQQSFWVKS 451 
261868275  378 VQS-DENQT-------FTDTEKTQLTNLLTERRKIASDVIKSLNNQLNLAISLELTQQQITQISDRIQAKLDQQSFWVKS 449 
197284047  483 NKPINLSWFSTFPDQAVAEFQSFKLNWSNENLLTGAKKSYPVLIALVLFSSILIWQRKKFDKQFDKLSADINKLNKDTQL 562 
251792160  451 NNPINMDWIKNLPMFLSTQFDGIVKKLGFPNDFDNLPYLLTYVFILVVIGGIIFKFKPAIKHRLGLINGQINTLRSDSQW 530 
68248800   456 NNPINLDWIKMLPRALIEQFNGMLKKLGFPTNYDNLPYLLMYFLGLFIVGGAIFKFKNRIKQQLNKINREIHRLDTDSQW 535 
165976165  447 NSPIDLDWFENFLPLASFQLKDLAKKFDFSNWKDNLVPAAVLELLLALGVLLISRQKERIKQRLTKINNSMRTVATDSQW 526 
152978639  453 NSVMDLDWFKSFPVSMNFQRRALKKNFDFSNWKENLLPALGMSGLLLILTTLIRRKKENIKKRLSKLNQQINIYATDTQW 532 
190150062  447 NSPIDLDWFENFLPLASFQLKDLAKKFDFSNWKDNLVPAAVLELLLALGVLLISRQKERIKQRLTKINNSMRTVATDSQW 526 
148827334  450 NNPIDLDWVKMLPRALIEQFNGMLKKLGFPTNYDNLPYLLMYFLGLFIVGGAIFKFKNRIKQQLNKINREIHRLDTDSQW 529 
126208228  447 NSPIDLDWFENFLPLASFQLKDLAKKFDLSNWKDNLVPAAVLELLLALGVLLISRQKERIKQRLTKINNSMRTVATDSQW 526 
52424920   452 NSNIDLKWLQDAPMLIRYQLRGIGNTFDFSNWRDNLVPAVFWILLLIALTAIIHRKKEKIKQQLTRINNKIKSLGTDNQW 531 
261868275  450 NNPLNLDWIKTLPMSLSTQFDGIVKKLGFPSNFDNLPYLLTYVFILVVIGGIIFKFKPAIKHRFALMNGEINTLRSDSQW 529 
197284047  563 HTPLALGIVFLKTLPLSCIVLAIGYWLINSFNVQQEFIWSFTWQFAVFWLMFEWSYRLMSDNGVAVNHFKIPLERVQQNR 642 
251792160  531 HTPIALFYTAILSLSATLWFLAICQMIGFFFFRNPNEFWQWSLSMAGYWWFFSFVLAVLRPNGILVRHFGFTQEGAEKLQ 610 
68248800   536 STPLALLLTAFLTLSSTLWFLAVCQMIGFFFFKNPEEFWHWSFSMAGYWWFFTFWISLFRPNGIFVNHFESSKENAQRFR 615 
165976165  527 NTPAAIFWTVILCLPSTFIFLMVFILVTYICFQDPTEVWPWGLKMSGYWLYFAFMVAMLRPNGIGFRHFNMPQKSNAVFR 606 
152978639  533 HTPKAIFWVAILSLPSTFLFLAGFILVTGICFKDPATVWSWGMKMAAYWWSFVFMLGMLRPNGIGHYHFNMPKESNEAFR 612 
190150062  527 NTPAAIFWTVILCLPSTFIFLMVFILVTYICFQDPTEVWPWGLKMSGYWLYFAFMVAMLRPNGIGFRHFNMPQKSNAVFR 606 
148827334  530 STPLALLLTAFLTLSSTLWFLAVCQMIGFFFFKNPEEFWHWSFSMAGYWWFFTFWISLFRPNGIFVNHFESSKENAQRFR 609 
126208228  527 NTPAAIFWTVILCLPSTFIFLMVFILVTYICFQDPTEVWPWGLKMSGYWLYFAFMVAMLRPNGIGFRHFNMPQKSNAVFR 606 
52424920   532 NTPLAIFWTIILCLPSTFMFLAVFILVTYICFQDPTQVWPWGLKMSVYWLSFAFLLAMLRPNGIGYTHFGMPKQSNETFR 611 
261868275  530 HTPIALFYTAILSLSGTLWFLAICQLVGFFFFRNPAEFWQWSLSMAGYWWFFSFLLAVLRPNGILVRHFGFSQETAEKFQ 609 
197284047  643 KRLLRLSLPMLPIILLSAYGINNPLLLVGDVIGQLVTIISLFFISLCALPFCRE----------MWQEKGNHVVRTVVIT 712 
251792160  611 SITKRIIVAVVLLLNTSIFSNVMDSGLANDVLGEINTIVALGFCIVIIAPRFNKavkt---fgdSAQDNRDKLILKIVRI 687 
68248800   616 GVIQRIIIVIVLLLNTSVFSNVTDAGLANDVLGQINTITALIFCAAIIAPRFNRvlr-----syEPETNKHHWLIRIVQI 690 
165976165  607 DILKRSVWVIGLMLNTAVFSHVTEIGIAYDVIGQVFTVIVLISIIFIVAPGFRQaiaiy-qnvaKDEESPRNVLLNIARA 685 
152978639  613 NMLKRSAWIIALLLNVSIFSHID-LGLSYDVIGQASMIIVLITVVLIMVPRFREamssy-qksaKEQTVTSQYFLPILRV 690 
190150062  607 DILKRSVWVIGLMLNTAVFSHVTEIGIAYDVIGQVFTVIVLISIIFIVAPGFRQaiaiy-qnvaKDEESPRNVLLNIARA 685 
148827334  610 GVIQRIIIVVVLLLNTSVFSNVTDAGLANDVLGQINTIAALIFCAAIIAPRFNRvlr-----syEPETNKHHWLIRIVQI 684 
126208228  607 DILKRSVWVIGLMLNTAVFSHVTEIGIAYDVIGQVFTVIVLISIIFIVAPGFRQaiaiy-qnvaKDEESPRNVLLNIARA 685 
52424920   612 K-ILKQSVWVIALLLNTSIFTNLEMGVTYDVLGQTMTIIVLIVTIFIVAPGFRKaistyqeatnNDKQGTHTYVLYLIRA 690 
261868275  610 SITKRIIVAVVLLLNTSIFSSVMDSGLANDVLGEINTIIALGFCILIIAPRFNRavta---fgaNTQDNRDKIILKIVRI 686 
197284047  713 LLTFSPLLLMGLVIFGYYYTALRLANRWIDSLYLLMLWFIAYHASLRGLTVAARRLAYRRALERRQAML----KEKKEG- 787 
251792160  688 LLRLVPVGLIVLIALGYYYTALNLISHVINTYIAWVVWSLVRHTVYRAITVASRRLAYRRLQEKLQQKA----VESNDGt 763 
68248800   691 GLRLIPVGLIVLIVLGYYYTALNLIEHFIHSYIAWCVWWLVRNTIYRGITVSSRRLAHRRLAEKRRQKAlennYENISSd 770 
165976165  686 VLFLAPITLVILIVLGYYYTSLVIIEHLVSTYFAVITWIILRNVFYRTFNVASRRLAFRRLQEKREQAL----AKVTNTe 761 
152978639  691 VLLLAPFVLIGLTVMGYYYTAIVLIEHAISSYFVVMTWWLIRNLAYRGFAVAARRMAYRRAKEKREQLQakaiAEANSS- 769 
190150062  686 VLFLAPITLVILIVLGYYYTSLVIIEHLVSTYFAVITWIILRNVFYRTFNVASRRLAFRRLQEKREQALakvtNTEQQIv 765 
148827334  685 GLRLIPVGLIVLIVLGYYYTALNLIEHFIHSYIAWCVWWLVRNTIYRGITVSSRRLAHRRLAEKRRQKAlennYENISSd 764 
126208228  686 VLFLAPITLVILIVLGYYYTSLVIIEHLVSTYFAVITWIILRNVFYRTFNVASRRLAFRRLQEKREQAL----AKVTNTe 761 
52424920   691 VLLLAPIILIVLIAVGYYYTALVLIEHLVATYFAVITWVIFRNIIQRAFSVTSRRLAAKRLQEKREQAR----AKAEASe 766 
261868275  687 LLRLAPVGLIVLVVLGYYYTALNLISHIINTYIAWVVWSLARHTVYRAITVASRRLAYRRLQEKRQQKQ----ADSNDG- 761 
197284047  788 ----------DdntlEPIQ-E---------PPMDMEQINQQSLRLTTMILFIIFASSFYGIWSDFITIFTYLDGITLWHY 847 
251792160  764 ---------sSddvvVVTEqE---------EGLALNEVRSQLMRFADLFVWTALFAIFYYVWSDLVTVVSYLRDITLWQQ 825 
68248800   771 dv-----vavG----EP---E---------EGLALNDVRSQLLRFVDLFIWTALLGIFYYVWSDLVTVVSYLREITLWQQ 829 
165976165  762 ----------Q----QIVQsEddipfdlreDTLAVSEIKNQMLKLTDMILWAALFALLYWVWSDLITVAYYLNGVTLWQQ 827 
152978639  770 ----------LspdmQEIQyD---------DSIAISEIRAQMLRVADFFLWIALFAMFYWAWWDLVTVAYYLDSISLWQQ 830 
190150062  766 qseddipfdlR---------E---------DTLAVSEIKNQMLKLTDMILWAALFALLYWVWSDLITVAYYLNGVTLWQQ 827 
148827334  765 dv-----vavG----EP---E---------ESLALNDVRSQLLRFVDLFIWTALLGIFYYVWSDLVTVVSYLREITLWQQ 823 
126208228  762 ----------Q----QIVQsEddipfdlreDTLAVSEIKNQMLKLTDMILWAALFALLYWVWSDLITVAYYLNGVTLWQQ 827 
52424920   767 ----------H----PEVDsGevil-evkeETLAVSEVKQQISKITDFLLWLCLFGLLYWVWSDLVTVAYYLDGVTLWKQ 831 
261868275  762 ---------------SPSD-Dvvmi-teqeEGLALNQVRSQLLSFADLFIWTALFAMFYYVWSDLVTVASYLRDITLWQQ 824 
197284047  848 NLPTELGNVVKAVTVADLLLSFAIMAISWFMIRNLPGLLEVLILSRIKLQQGASYAITTILTYIIIAIGTIVSLGILGVA 927 
251792160  826 TTTTETGMVTESISLFNLIVALVIVAITYILVRNIPGILEVLVFSRVKLSQGTPYTINTLLTYILVAIGSAWAFATLGMS 905 
68248800   830 TTTTDAGTVIESITLFNLLVALVILGITYVLVRNISGILEVLIFSRVNLSQGTPYTITTLLTYIFIAIGGAWAFATLGMS 909 
165976165  828 ATETAQGVVMESITLLNLLVAFGILFVTYVLIRNLSGLLEALVFSNLKLSQGTPYTVTTLLTYLLVVLGATFAFATLGMS 907 
152978639  831 TTVGENGTVTESITLLNLFIAIAIIVVTYVLVRNISGLLETLIFSHTKLSQGTPYTITTLFTYAIIAFGATFAFGALGMS 910 
190150062  828 ATETAQGVVMESITLLNLLVAFGILFVTYVLIRNLSGLLEALVFSNLKLSQGTPYTVTTLLTYLLVVLGATFAFATLGMS 907 
148827334  824 TTTTDAGTVMESITLFNLLVALVIVGITYVLVRNISGILEVLIFSRVNLSQGTPYTITTLLTYIFIAIGGAWAFTTLGIS 903 
126208228  828 ATETAQGVVMESITLLNLLVAFGILFVTYVLIRNLSGLLEALVFSNLKLSQGTPYTVTTLLTYLLVVLGATFAFATLGMS 907 
52424920   832 SVTTESGTVMESVTLFNLLIAILVLFATYVLVRNIGGVLEVLIFSNLKLSQGTPYTITTLLTYAVIALGASFAFGTLGMS 911 
261868275  825 ISTTEAGVVTESISLFNLLVALVIISITYILVRNIPGILEVIVFSRVRLSQGTPYTINTLLTYILVAIGGAWAFATLGMS 904 
197284047  928 WEKLQWLAAALTVGLGFGLQEIFANFVSGIIILFERPVRIGDTVTIGSYSGTVSRIRIRATTVTDFDRKEVIIPNKAFVT 1007
251792160  906 WSKLQWLFAALSVGLGFGMQEIFANFVSGIILLFERPIRVGDTVTINDVSGTVAKIRIRAITLIDPDRKEVIVPNKSFVT 985 
68248800   910 WSKLQWLFAALSVGLGFGMQEIFANFVSGIILLFERPIRVGDVVTINGVSGTVAKIRIRAITLIDFDRKEIIVPNKSFVT 989 
165976165  908 WSKLQWLFTALSVGLGFGMQEIFANFVSGIIILFERPVRIGDMITIGTFNGTVSKIRIRATTLIDNDSKEVIVPNKAFIT 987 
152978639  911 WSKLQWLFAALSVGLGFGMQEIFANFVSGIIILFERPVRIGDIITLGEFSGTVSKIRIRATTLVDFDGKEVIVPNKSFVT 990 
190150062  908 WSKLQWLFTALSVGLGFGMQEIFANFVSGIIILFERPVRIGDMITIGTFNGTVSKIRIRATTLIDNDSKEVIVPNKAFIT 987 
148827334  904 WSKLQWLFAALSVGLGFGMQEIFANFVSGIILLFERPIRVGDVVTINEVSGTVAKIRIRAITLIDFDRKEVIVPNKSFVT 983 
126208228  908 WSKLQWLFTALSVGLGFGMQEIFANFVSGIIILFERPVRIGDMITIGTFNGTVSKIRIRATTLIDNDSKEVIVPNKAFIT 987 
52424920   912 WSKLQWLFAALSVGLGFGMQEIFANFVSGIIILFERPVRIGDVITLGEFNGTVSKIRIRATTLVDFDGKEVIVPNKAFVT 991 
261868275  905 WSKLQWLFAALSVGLGFGMQEIFANFVSGIILLFERPIRVGDTVTINDVSGTVAKIRIRAITLIDFDRKEVIVPNKSFVT 984 
197284047 1008 ERLINWTLSDTVTRIIIQVGVAYGSDLDKVKTILMKAAKDNPKVMTEPEPVVLFTEFGASTLNHELRFYVRTLGDRNTAI 1087
251792160  986 GQVINWALSNTVTRLVISIGVAYGSDLALVKRLLLQAANEQPSVLKDPEPRALFLSFGASTLDHELRVYVGQLSERINTI 1065
68248800   990 GQVTNWALSSTMTRLVISVGVAYGSDLTLVRQLLLQAADEQPTVLRDPKPSAYFLTFGASTLDHELRVYVEQVGDRTSTT 1069
165976165  988 ERIVNWALTSSMTRLVISVGVAYGSDLELVKRLLLQAAEENPSVLKDPPPVVYFLTFGASTLDHELRVHVGQISDRMRTM 1067
152978639  991 ERLVNWALSDTVTRVIAHVGVAYGADLELTKKLLLQAADDCELVMKDPAPVVYFLNFGASTLDHELRVYVGHVGDRNPTL 1070
190150062  988 ERIVNWALTSSMTRLVISVGVAYGSDLELVKRLLLQAAEENPSVLKDPPPVVYFLTFGASTLDHELRVHVGQISDRMRTM 1067
148827334  984 GQVTNWALSNTMTRLVISVGVAYGSDLTLVRQLLLQAADEQPTILRDPKPSAYFLTFGASTLDHELRVYVEQVGDRTSTT 1063
126208228  988 ERIVNWALTSSMTRLVISVGVAYGSDLELVKRLLLQAAEENPSVLKDPPPVVYFLTFGASTLDHELRVHVGQISDRMRTM 1067
52424920   992 ERLVNWALSDTVTRVIIRVGVAYGSDLELTKKLLLQAADDCDKVLKTPSPVVYFLTFGASTLDHELRVYVGNISDRNPTI 1071
261868275  985 GQVINWALSNTMTRLVIRVGVAYGSNLELVKKLLLQAANEQPAVLKDPEPRALFLSFGASTLDHELRVYVGQLSERTNTI 1064
197284047 1088 DEVNRAIDKLCNENDINIAFNQLEVYLHNKQGEEV---QEIk-----KGpldGSTPEANTP 1140
251792160 1066 DALNRRINELFAKHNIDIAFNQLDVFIKNKDTGVMmplVDV------KS------------ 1108
68248800  1070 DAINRRINELFAEHNIDIAFNQLDVFIKNNDTGEEipfVDV------KK------------ 1112
165976165 1068 DELNRRINQLFAEHNIEISFNQLDVFIKNQATNEE---VKW-----------ATEKFNDKN 1114
152978639 1071 DYLNRRINQLLAENNIEIAFNQLDIFIKNPTTNEE---VKVgetvefKK------------ 1116
190150062 1068 DELNRRINQLFAEHNIEISFNQLDVFIKNQATNEE---VKW-----------ATEKFNDKN 1114
148827334 1064 DALNRRINELFAEHNIDIAFNQLDVFIKNNDTGEEipfVDV------KK------------ 1106
126208228 1068 DELNRRINQLFAEHNIEISFNQLDVFIKNQATNEE---VKW-----------ATEKFNDKN 1114
52424920  1072 DFLNNRINTLLAQHNIEIAFNQLDVFIKNQNADEE---VKL-----------GNEQLKLQK 1118
261868275 1065 DSLNRRINELFTENNIDIAFNQLDVFIKNQDTGAVmplIEV------KS------------ 1107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap