Conserved Protein Domain Family
PRK11423

?
PRK11423: PRK11423 
methylmalonyl-CoA decarboxylase; Provisional
Statistics
?
PSSM-Id: 236908
View PSSM: PRK11423
Aligned: 44 rows
Threshold Bit Score: 400.557
Threshold Setting Gi: 170732252
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78065512    7 HDSASHVTVDmvgeRIARVRFANPARRHALDAPLLDALVACLDALAEHRpPPVVILSNDGSGDVWSAGHDLREL-ADDRD 85 
253699339   1 MAVITTQLQD----NIGTITFNDPDHRNALSGALINEMLQSIGALQKGK-MRVLVIRAPKGSKVWSAGHDVHELpMPGRD 75 
148265556   1 MSLISIHCAD----EIATITFTNSARRNALSNAMIEEVLHAVHDFEQNK-MRVLVLRAERGVKVWSAGRDVTELpQPCRD 75 
189424442   1 MSQILTAVYN----QVATIALNHPETRNSLSCQMLEEMLQAIEQFSHDEnVRVLVIRAPRGTKVWSSGFNIHELpVSGRD 76 
197117080   1 MAVISTQLQD----NIGTITFNDPDHRNALSGVLIDEMLQSIGALQKGK-MRVLVIRAPKGSKVWSAGHDVHELpMPGRD 75 
91777142    5 HPSPFTVTVDivdeRIARLTFSHPTRRNALSAELLQALDTRLVELAARR-IPVVILGSGVGQDVWSAGHDLGEL-AHDRD 82 
206561414   7 HDAASTVTVDligeRIARVRFANPARRHALDAPLLDALVAHLDALAARRpPPVVILSNDGSGDVWSAGHDLREL-ADDRD 85 
107022017   7 HDGASSVTVDwigeRIARVRFGNPARRHALDAPLLDALVAHLDALAGHRpPPVVILSNDGSGDVWSAGHDLREL-ADDRD 85 
116688961   7 HDGASSVTVDwigeRIARVRFGNPARRHALDAPLLDALVAHLDALAGHRpPPVVILSNDGSGDVWSAGHDLREL-ADDRD 85 
170732252   7 HDGALSVTVDwigeRIVRVRFGNPARRHALDAPLLDALVAHLDALAGHRpPPVVILSNDGSGDVWSAGHDLREL-ADDRD 85 
78065512   86 PLAYGKPLERALRRVRTYPGAVIAAVAGSAWGGAVDLVMSCDLVVAARDARFAMTPANIGLPYSTSGLLRFYDNLPIHVL 165
253699339  76 PLAYNDPLVTVLRSIQSLPIPVIAMIEGSVWGGACDLALSCDILIGCHSSTFCMTPAKIGVPYNVSGILHFMNIMGVNFA 155
148265556  76 PLEYGDPLEIILRQVQECSMPVIAMLEGSVWGGACDLVLSCDIVIGCPTTSFCMTPAKIGVPYNVTGILHFLNIMGANLA 155
189424442  77 PLSYNDPLECLLRAVARFHSPVIAMIEGSVWGGACDLSFVCDIAIGCPTSSFAITPAKLGVPYNISGIMHFFNIVGPRIA 156
197117080  76 PLAYNDPLVTVLRSIQSLPIPVIAMIEGSVWGGACDLALSCDILIGCHSSTFCMTPAKIGVPYNVSGILHFMNIMGVNFA 155
91777142   83 PIAYGKPLEQALRRVRAYPGVVIAMVSGSAWGGAVDLAMSCDLVVADETARFAMTPANIGLPYTTSGLLRFFNNVPIHVL 162
206561414  86 PLAYGKPLERALRRVRTYPGAVIAAVAGSAWGGAVDLVMSCDLVVAARDARFAMTPANIGLPYSTSGLLRFYDNLPIHVL 165
107022017  86 PLAYGKPLERALRRVRTYPGAVIAAVAGSAWGGAVDLVMSCDLVVAARDARFAMTPANIGLPYSTSGLLRFYDNLPIHVL 165
116688961  86 PLAYGKPLERALRRVRTYPGAVIAAVAGSAWGGAVDLVMSCDLVVAARDARFAMTPANIGLPYSTSGLLRFYDNLPIHVL 165
170732252  86 PLAYGKPLERALRRVRTYPGAVIAAVAGSAWGGAVDFVMSCDLVVAARDARFAMTPANIGLPYSMSGLLRFHDNLPIHVL 165
78065512  166 KEMFFCAQPLDAERAAHHGLVNRLADAGGVDDAALDVARTIAAKAPLAVHAVKEQLRVLQDARPLPADAFERIAELRRQA 245
253699339 156 KEMFFTAEPLSAEEAVRAGLLNHLIENEQIEEFTYAMAGKITKNSPLSIGVIKEQIRLLASAHPLSPLTFERVQGLRRTV 235
148265556 156 KEMFFTAEPLSAERAANFGIINHLVQTEELEGFTYEMARRITRNSPLTISVIKEQVRLLSCAHPLSPPTFERIQGLRRKV 235
189424442 157 REMFYTAEPISAERALQVGILNHLVSVEELEAFTYAMAGRIADNSPLANRVMKEQLRLLADAYPLRPETFEYVQGLRRMA 236
197117080 156 KEMFFTAEPLSAEEAVRAGLLNHLVESEQLEDFTYAMAGKITKNSPLSIGVIKEQIRLLASAHPLSPLTFERVQGLRRTV 235
91777142  163 KEMFFAAQPLDAARAERFGVVNRLVGSDRLEATALDMARGIAAKAPLAIQAVKEQLRILEDLQPLPVQAMEQIAELRRQA 242
206561414 166 KEMFFCAQPLDAECAAHHGLVNRLADAGEVDDAALDVARTIAAKAPLAVHAVKEQLRVLQDARPLPADAFERIAELRRHA 245
107022017 166 KEMFFCAQPLDAERAAHHGLVNRLADAGGVDDAALDVARTIAAKAPLAVHAVKEQLRVLQDARPLPADAFERITELRRLA 245
116688961 166 KEMFFCAQPLDAERAAHHGLVNRLADAGGVDDAALDVARTIAAKAPLAVHAVKEQLRVLQDARPLPADAFERITELRRLA 245
170732252 166 KEMFFCAQPLDAERAAHHGLVNRLADAGGVDDAALDVARTIAAKAPLAVHAVKEQLRVLQDARPLPADAFERITELRRQA 245
78065512  246 CEGADFSEGLRAFAARRAPVFRGV 269
253699339 236 YDSKDYAEGIKAFLEKRTPVFSGE 259
148265556 236 CDSKDYMEGINAFLEKRDPSFKGE 259
189424442 237 YDSKDYEEGKRAFLERRKPVFSGK 260
197117080 236 YDSKDYAEGIKAFLEKRTPVFSGE 259
91777142  243 CESADFSEGLAAFSERRPAVFGGT 266
206561414 246 CEGADFDEGLRAFAERRAPAFRGI 269
107022017 246 CEGADFDEGLRAFAERRAPVFRGA 269
116688961 246 CEGADFDEGLRAFAERRAPVFRGA 269
170732252 246 CEGADFDEGLRAFAERRAPVFRGI 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap