1BP1


Conserved Protein Domain Family
BPI2

?
cd00026: BPI2 
Click on image for an interactive view with Cn3D
BPI/LBP/CETP C-terminal domain; Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain; binds to and neutralizes lipopolysaccharides from the outer membrane of Gram-negative bacteria.; Apolar pockets on the concave surface bind a molecule of phosphatidylcholine, primarily by interacting with their acyl chains; this suggests that the pockets may also bind the acyl chains of lipopolysaccharide.
Statistics
?
PSSM-Id: 237993
View PSSM: cd00026
Aligned: 16 rows
Threshold Bit Score: 172.1
Threshold Setting Gi: 2599572
Created: 1-Nov-2000
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
apolar bindingBPI
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:apolar binding pocket
Evidence:
  • Comment:formed mainly by alpha helices and the beta sheet beneath them
  • Comment:binds acyl chains of phosphatidylcholine
  • Comment:may also bind acyl chains of lipopolysaccharide
  • Citation:PMID 9188532
  • Structure:1BPI, binds phosphatidylcholine
    View structure with Cn3D
  • Comment:is not conserved among other memebers of the family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #    #  #   #  #                                                           
1BP1      253 MVYLGLSDYFFNTAGLVYQEAGVLKMTLRDdmipkeskfrLTTKFFGt-----fLPEVAKKFPn-MKIQIHVSASTPPHL 326 human
A35843    272 MVYFAISDYVFNTASLVYHEEGYLNFSITDdmippdsnirLTTKSFRp-----fVPRLARLYPn-MNLELQGSVPSAPLL 345 Homo sapiens
2599572   241 HLILALSEHFYTSLYFTLERAGAFNMTIPSm---------LTTATLAq-----kITQVGSLYHedLPITLSAALRSSPRV 306 chicken
AAA87581  278 PFSLTVRQDLVNAIVTTLVPKEELVILLRFvipd--varqLQMDIKEi------NAEAANKLG--PTQMLKIFTHSTPHI 347 Mus musculus
AAM00906  277 PFRLTVRKDVVVAIIAALIHSGKLTVLLDYvlpe--varqLRSSIKVi------DETAAAQLG--PTQIVKIMSQTTPML 346 cow
CAC18884  254 MATVGLSQQLFDSALLLLQKAGALNLDITGqlrs--ddnlLNTSALGr-----lIPEVARQFPepMPVVLKVRLGATPVA 326 human
AAL60017  314 MVTISVEEGVFNSATLVYFNAKVMHLVMEEtkn----gsiLSTSDWKl-----iLPELYKHYPd-NKMVLNMSVTSPPAV 383 thale cress
NP_563724 281 MLGISVDEAVFNSAAALYYNADFVQWVVDKipe----qslLNTARWRf-----iIPQLYKKYPn-QDMNLNISLSSPPLV 350 thale cress
Q10011    280 MLTSWISVSIPNCLIHSAHQNQLVKLLVSKdipvv-epylRTSCGFLglcigkfFKKLRNEYPn-NHVDLFFHTYSTPYF 357 Caenorhabditis ele...
AAH19847  263 MVYVAFSEFFFDSAMESYFRAGALQLLLVGdkvphdldmlLRATYFGs------IVLLSPAVId-SPLKLELRVLAPPRC 335 Homo sapiens
Feature 1            #                                 # #          #                         
1BP1      327 SVQPT-GLTFYPAVDVQAFAVLPnsa-lasLFLIGMHTTGSMEVSAes--nRLVGELKLDRLLLELKHSnigpf-pvelL 401 human
A35843    346 NFSPG-NLSVDPYMEIDAFVLLPsss-kepVFRLSVATNVSATLTFnt--sKITGFLKPGKVKVELKESkvglf-naelL 420 Homo sapiens
2599572   307 VLEEG-RAALKLFLTVHIGAGSPdfq--sfLSVSADVTRAGLQLSVsdtrmMISTAVIEDAELSLAASNvglv--raalL 381 chicken
AAA87581  348 VLNEG-SARAAQSVVLEVFPTNTdv---rpFFSLGIEASYEAQFFTed-nrLMLNFNNVSIERIKLMISdiklf-dpevL 421 Mus musculus
AAM00906  347 ILDQG-NAKVAQLIVLEIFATDKds---rpLFTLGIEASSDIQFYVed--gLLVFSFNEIRADRIHLMNsdigvfnpklL 420 cow
CAC18884  327 MLHTN-NATLRLQPFVEVLATASnsa-fqsLFSLDVVVNLRLQLSVsk-vkLQGTTSVLGDVQLTVASSnvgfi-dtdqV 402 human
AAL60017  384 KITEN-GIDATIQLDIAFDVQDSgen--lsVARLSTILSVACSTEIvk--nNLIGSLRLNDFNATMKWSkigef-qtnyV 457 thale cress
NP_563724 351 KISEQ-YVGANVNADLVINVLDAnqv--ipVACISLMIRGSGALRVmg--nNLGGSVSLEDFSMSLKWSnignl-hlhlL 424 thale cress
Q10011    358 VMSEKeGVMLNMSLAVDLFINPYaktkqniLARLVVDTFSTVEPFLnh--tRIHGRLQNSTITARVDFSnigd--ipkaF 433 Caenorhabditis ele...
AAH19847  336 TIKPS-GTTISVTASVTIALVPPdqp-evqLSSMTMDARLSAKMALrg--kALRTQLDLRRFRIYSNHSalesl-alipL 410 Homo sapiens
Feature 1                #   #   #   #                      #       
1BP1      402 QDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYN-VVLQPHQNFLLFGADVV 454 human
A35843    421 EALLNYYILNTLYPKFNDKLAEGFPLPLLKRVQLYD-LGLQIHKDFLFLGANVQ 473 Homo sapiens
2599572   382 EELFLAPVCQQVPAWMDDVLREGVHLPHMSHFTYTD-VNVVVHKDYVLVPCKLK 434 chicken
AAA87581  422 KDTLTKILEYTLLPNENGKLRTGIPMSMSKALGYEK-AMWSVSKGALKLTPASS 474 Mus musculus
AAM00906  421 NNITTKILTSILLPNENGKLRSGIPVSMVKNLGFKS-ISLSLTKEALVVTQASS 473 cow
CAC18884  403 RTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVA-PEIFVYEGYVVISSGLF 455 human
AAL60017  458 QAATSRILEALFLPYVNTRLKRGFPLPIPGDFTIKN-IKIVYVNSGILVCTDIG 510 thale cress
NP_563724 425 QPIVWTVIQTVFVPYANDHLEKGFPLPIMHGFTLQN-AEIICSESEITVCSDVA 477 thale cress
Q10011    434 LSAFSSILSMTAREAVRSVLGVGIPIPSYDNVTLADsSTIEVFDQFLRANIDFE 487 Caenorhabditis elegans
AAH19847  411 QAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVH-EVVTNHAGFLTIGADLH 463 Homo sapiens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap